LOCUS E.coli 10775 bp RNA RNA 11-JAN-1980 DEFINITION Escherichia coli. ACCESSION No information KEYWORDS No information. SOURCE Escherichia coli. ORGANISM Escherichia coli. REFERENCE 1 AUTHORS No information JOURNAL E.coli:who:Published STANDARD No information COMMENTS Organism information Culture collection: ? Sequence information (bases 1 to 10775) Corresponding GenBank entry: J01695 Phylo:Eubacteria,Purple,gamma,3 BASE COUNT 762 a 639 c 912 g 591 t 7871 others ORIGIN 1 |--------- ---------- ---------- ---------- ---------- ---------- 61 ---------- ---------- ---------- ---------- ---------- ---------- 121 ---------- ---------- ---------- ---------- ---------- ---------- 181 ---------- -----GGU-U AAGC------ -GA------- ---------- ---------- 241 ---------- ---------- ---------- -----CUAAG CGUACACGG- ----UGGAUG 301 |CCC--UGG| CAG-UCAG-A G|gcgaug-- ---------- ----AAGGA| -CGUG(-CUA 361 AUC------) U|GCGAUAA- GCGUCGG|UA A-GGU--(-- ---------- ---------- 421 GAUAUGA)-- ACCGUUAUAA CCGGCGA-UU UCCGAAU-GG G--------- -----(GAAA 481 )CCC|AGUGU GU(UUCG-)A CACACU---- AUCAUUAACU GA-------- -(AUCC-A)- 541 --------UA GGUUAAUGAG G--<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- -----cGAAC |CGGGGGAAC 841 UGA(AACA)U CUAAGUA--- -CCCCG---- ---------- ---------- ---AGGAAAA 901 GAAAUC(-AA CC)GA-G-AU |UCC-CCCA- -GUAG-C(-G GCGA)GCGAA -CGGGGAGC- 961 -AGCCCA<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---gagccug aaucagugug uguguuagug gaaGCGUCU< ---------- ---------- 1261 ---------- ---------- ---------> (GGAA--)AG GCGC------ GC-|G(AUA) 1321 C--AGGG(UG ACAGC)CCCg ua--cacaaa aaugcacaug cugugagcuc g-<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >auGAGUAGG GCGGGA(--- --------ca 1561 cguggua)UC CUGUCUGAAU ----auGGGG G(GACCA-U) -CCUCCA--A GGCUA-AAUA 1621 ---CUCCUGA C-UGACCGAU AGUG-AA--- -CCAGUACC( -GUGA-)GGG ---AAA-GG- 1681 CG-------- ---------- ---------- ---------- ---------- ---------- 1741 AAAAGAACCC C(GGCGA--) GGGG------ ---------- ------AGUG AA--AAAGA- 1801 ACCUG-AAAC CGUG-UAC-G U-<------- ---------- ---------- ---------- 1861 ----->ACAA GCAGUGGGAG CACGC---<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (-----uuag 2041 --)---GCGU GUGACUGC-G UACCUU(UU- GUAUA)AUGG |GUC-AGCGA CU-----UA- 2101 UAUUCUGUAG CAA--gguua a-cc---(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ------gaau a)-----ggg --gagc-cGA 2521 AGG-(-GAAA )--CCG<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->AGUC U-(UAACU-) -G-GGCG--- -----UUAAG UUGCA-GGGU 2701 AUA-GACCCG AA-ACCCG-G UG-AUCUAGC CAU-GGG-CA GGUUGAA--- G-GU--UG-G 2761 G(-------- ---------- ---------- ---------- -----uaac) ACUAACUGGA 2821 GGACCGAA-C CGAC-UAAU( GUUGAAA-A) AUUA-GCGGA --UGACUUG- UGGCUGG-GG 2881 GU(G-AAAG) GCC-AAUC-A A-ACCGGGAG AUAGCU-GGU UCUCC--CCG AA-AGC-UAU 2941 (-UUAG)GUA GC-GC-CUCG UGAA<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->UU CAU|-CUCCG 3061 G|GGGUAG|A GCACUGU-UU CG-gca--ag gggguc--(a uccc----)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->--gac uua-cc-aac 3301 cCG--AU-GC AAACUGCG-- AAUA|-CCGG -A-G--AAUG ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -UUA--UC-A -CGGG-AGAC ACACG--GC- GG-GU(-GCU 3481 AAC)GUCCGU CG-UG----A AGAGGG(AAA -CAA)CCC-A GACCG-C-CA -GC-UAA--- 3541 --GGU-CCCA -AAGUCA-U- GGUUAAGUG- ---------- GGAAACGAU- GUGGGAAGGC 3601 C-C------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AGACA-GCCA G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAUGU-U GGC(UUAGAA 3781 GC-A)-GCCA -UCAU|U(U- AA)A|GAAAG C(--GUAAUA )GC|-UCAC- UGGUCG<--- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 ->AGU-CG-G -CC-UGC|-G CGGAAGAU-- ---------- ---------- ----GUAACG 3961 GGGCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ----AAACCA UGC------- ---------- ---------- ---------- 4081 -------|AC CGAA--GCU| G--C-GG|CA Gcgacgc--- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 uau---)--- -gcguug-UU -G-----GGU AGGGG-AG|- CG-UUCUGUA A---GCCUGC 4501 G--------A AGGUG-UGCU (GUGA---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->GG CAU--GCU-G G|AGGU---| AUCAGAAGUG CGAAUGC-UG 4681 AC|AUAAGUA -ACGA-UAA- AGC-GG-GU- (gaaaa---- ---------- ---------- 4741 ---------- -----)-G-C CCGCU-|CGC C-GGAA-GAC CAA--GGGUU -|----CCUG 4801 UCCAA---CG ---------- ----(--UUA AU)C-G|-GG GCAGGG---- ---------- 4861 ---UGAGU-- -CGACCCCUA A-G-G-C--- GAGGCC-(-G AAA------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--GGC---G UA---G-UCG AU-GGGAAA- CAGG(----- ---------- ---------- 5041 ---------- --uuaauauu ----)CCUGU |---AC|UUG G--UGUUACU |GC<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-G AAGGGGG-GA CGGAGAAGGC UAUGUUG--G 5461 CCGGG(CGAC GGUUGU)CCC GGU|UUAAGC GUGUAGGC|U GGUUUUCCAG G(CAAAU)CC 5521 |GGAAAAUCA AGGCUGAGGC GUGAUGACGA GGCAC(UACG )GUGCUGAAG CAACAAAUGC 5581 CC<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->UG CUUCCAGGAA ----AA-GCC UCU<------ 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>AAG CAUCAGGUAA CAUCAA---- -AUCGUA|CC 6481 C--CAAACC- -(GACACA)G G|UGGUC-AG GUA-(GAG-A A-----)-UA CCAAGGCGC| 6541 |--UUGAG-A G--AACUCGG -GUGA-AGGA ACUAGGCAAA AUGGUG-CCG UAAC(UUCG- 6601 )GGAGAA-GG CAC|GCUGAU AUGUAGGUGA GGUCC(--CU CGC)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->GGAUGG AGCUGAAAUC 6781 -AGU|C(GAA )G--AUACCA GCUGGCUG|C AA---CUG-U UU(AUUAA)A AA-CACA-GC 6841 ACUGUG|CA- -AACAC---- ---------- (--GAAA--- ------)--- ---------- 6901 GUGGACGUA- UAC-GGUGUG ACGCCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-GU|G CCGGAA-GGU UAAUUG-AU- 7021 --GGGGUUAG C-(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------G CAA)GCGAAG CUCU--UGAU C-GAAGCC-| 7141 CC-GGUA-AA C-|GG-C|-G -GCCGU-(AA CUAUA)ACGG UC|C(UAA)- GG-UAGCGAA 7201 AUU-CC-U-U |GUCGGG(-U AAGU-)UCCG AC|CU-GCAC GAAUGGCGUA A-UGAUGGCC 7261 AG-------- ---------- -------GCU GUCUCCACCC GAGA-CU-CA ----GUGAAA 7321 UU|G|AACUC GC-UG(U-GA AGAUG)CAGU GUA----CCC GCGGCAAGAC GGAAAG-ACC 7381 CCGUGA-|-A CCUUU--ACU AU|--A-GCU UGA--CACU| <--------- ---------- 7441 ---------- ---------- --->GAACA- UU-----GAG -CCUUGAUG- UGU---AGGA 7501 UAGGUGGGA- -GGCUUU-GA A-GUGUGGAC --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----GCC A)-GUCUG-C AUG--GAGCC 7681 GACCUUGAAA UACCACC|c- ----uUUAA- U-G-U-UUGA UGUU-CUAA- -CGUUGA--- 7741 CCCG-(---U AAUC)-CGGG ---------- ---------- ---------- ---UUGCG<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->-GAC AGUGU-C-UG -GUG-GG-UA GUUUGACUG( 8161 GGG)CG-GU- C|UCCUCC(- --------UA AAGAGUAAC- )GGAG-GA|G |C|ACGA-|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->A-GG-UUG 8401 -GC|--UAA- UCCUGG<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (ucggaca-- )----UCAGG AG-------- ---------- 8701 ---------- ---------- ---------- ---GUUA|GU (G|CAAUG)G CAU-AAG-CC 8761 A-GC-UUGAC UGCGA-GCG( -ugacgg--- )CGCGA-GCA G--------- ---------- 8821 ---------- --------GU GC-------- ---(GAAA-- -)-------- ----GCA-GG 8881 U|---CAUAG UGAUC-CGGU GG-U------ ---------- UCU(------ ---------- 8941 ---------- ---------- ---------- ---------- ----GAAUGG AA)GG|GCCA 9001 UCGCUCAAC- |GGAUAAAAG GUACUC|CGG G|GAUAACAG |G-CUG-A-U ACCGCCCAAG 9061 AG(U--UCAU )AUCGACGGC --GGUGUUUG GC-ACCUCGA UGUC|GG--C U|C|AUCAC| 9121 AU-CC-UGGG GC-UG(--AA -GU)AGGUCC CAAG-GGU|A UGGC(UGUUC )GCCAU-UUA 9181 A--AGUGGU- --ACGCGAGC UGGGUUUAGA AC|GU-C(GU GA)GACAGUU CGGUCCCUAU 9241 CU|GCCGU-G GG|C|<---- ---------- ---------- ---------- ---------- 9301 >GCUGG-AGA AC-UGA-GGG GGG-CUG-CU CC--(UAGU- AC(-GAGA)G GACC-)GGAG 9361 U--GG-<--- ---------- ---------- -------->A CGCAUCA-CU GGUGUUCGGG 9421 U|-UGU-CAU (GCCA-)<-- ---------- ---------- ---------- ---------- 9481 ---------- ---------- ---------- ---------- ---------- ---------> 9541 AUG-GCACUG CCCG--GUAG CUAA-AUGCG GAA------- ---------- -------GAG 9601 ---------- -AUAAGUGCU (GAAAGC--A U-CUA)A-GC -AC-GAAACU UG-CCCCGAG 9661 AUGAG--U-- -UCUCC-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>CU| GACCCU(UUA )AGGGUC-cu gaaggAA|CG 9961 UUG(AAGACG A--)CGACGU U--------- ---------- ---------- ------GAUA 10021 G|GCCGGGUG ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---UGUAAGC GCA------- ---------- --------(- ---------- 10141 ---------- -------GCG A)UGCGU--- ---------- ---------- ---------- 10201 ----UGAGCU A|A|CCGGUA CUAAU-g--- ---------- ---------- -----aaccg 10261 u--------- ---------- ---------- ---------- ---GAG---- ---GCUUAAC 10321 Cuu-----|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (1)-EUKARY 10775 bp RNA RNA 27-JAN-1998 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......-.. .......-.. .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... ......-... .......... ..-....... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .-........ .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......--. .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .....---.. .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 --........ .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .-........ 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .-........ 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .....-.... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .....-.... ..)....... .......... .......... 4861 .......... .......... .-........ .......... ....------ ------.... 4921 .......... .......... .......... .......... .......... ........-- 4981 .-........ .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... ......-... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... ......-... .......... 6481 .......... .......... .......... .......... .-----.... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .-......-- ------.... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... ......-... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... ...-...... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......-.. -......... .......... 8161 .......... .......... .......... .......... .......... .......-.. 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... ..-------- ---......- -.-------- ----...... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... ..-....... ...-...... .......... ...-...... .......... 9361 .....-.... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... ....-..... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .|........ .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (2)-DICTYO 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.D.dis.1 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Dictyostelium discoideum. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Dictyostelium discoideum. ORGANISM Mitochondria Dictyostelium discoideum. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: D16466 Dictyostelium discoideum mitochondrial LSU rRNA Yoshimasa Tanaka, University of Tsukuba, Japan Unpublished Robin, Yoshimasa Tanaka says it's O.K. to send you the Dictyostelium discoideum mitochondrial LSU rRNA sequence, so here it is. Mike This sequence has since been published. BASE COUNT 1061 a 370 c 618 g 823 t 7903 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~agu-a agag------ ---------- ---------- ---------- 241 ---------- ---------- ---------- -----aaaaA UGUUUAUAA- ----CGGAUC 301 |UCU--AUG| CAA-AUAA-g a|aaa----- ---------- -----agga| -cgua(-cga 361 aug------) a|acgaaag- guuauag|gg a-aaau-(-- ----auaaaa aagaguuagc 421 aauagca)-- auug-aagau cuauaaa-ua uccgaag-gg ---------- -----(aga- 481 )-cc|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---<-aagaa aaagaa---- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- -----gAAAC |GCAGUGAAG 841 UGA(AACA)U CUUAGUA--- -ACUGU---- ---------- ---------- ---AGGAAAA 901 AAAAUC(-AA AA)GA-G-AU |GCG-GUAA- -GUAG-U(-G GUGA)GCGAA -AGCCGAgg- 961 -agagua<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 --aaaguaga ccauuagaag aaaacugaag aaacuaggu< ---------- ---------- 1261 ---------- ---------- ---------> (ggaaa-)uc caag------ GC-|A(GAA) 1321 U--AAGG(UG AAAGU)CCAg ua--agguaa gggacuaaug guaa------ ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >agAAGUAAA ACGAAG(--- --------aa 1561 aggagga)AU UUGUUUGAAA ----AAUGGG G(GCCCA-C) -CCCCAA--A CUCAA-UAUA 1621 ---UGCUUAU U-UGACUGAU AGUG-AA--- -CAAGUACU( -GUGA-)AGG ---AAA-GA- 1681 UG-------- ---------- ---------- ---------- ---------- -------aaa 1741 aggaauauag a(aguua--) ucua------ ---------- ---uucAGUG AA--A-AGA- 1801 CCGUG-AAAU UGUA-AAC-A U-<------- ---------- ---------- ---------- 1861 ----g>auga gCAguuggag u-------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (------uaa 2041 --)------- gugacaac-G UACCUU(UU- GUAUA)AUGG |GUC-AGCGA GU-----UA- 2101 AUAAAUcgua gca-agcuua a-ggu--(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- -------agu a)----acua --uagg-cGC 2521 AGC-(-GAAA )--GCG<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->uauc u-(uaaua-) -g-ggug--- uuucaagagu uac-A-UUUA 2701 UUA-GACCCG AA-ACCAA-G CG-AUCUAAU UAU-GAA-CA CGC-auu--- u-ua--uu-a 2761 u(-------- ---------- ---------- ---------- -----uuuu) auuuuaauuu 2821 G-GCGGAA-C CC-GUAACU( GUUGCAA-A) AGUU-UGGGA --UGAUUUG- UGAUUAG-GG 2881 GU(G-AAAG) GCU-AAUC-A A-GCUUGGUG AUAGCU-G-U UUUUU--ACG AA-AUC-UAU 2941 (-CUAG)GUA GA-AC-GGUG GUauaa AAU|-UUAUA 3061 G|AGGUAG|A GCACUGA-AU GG-uuc--aa c-------(c uaag----)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ----gu---u 3301 AUU--AU-UU AAACUUCG-- AAUA|-CUAU -A-A---aua ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -aauu-gA-C -CACU-AGGC AGACU--AU- GA-GC(-GCU 3481 AAG)GUCCAU AGgUC----U AAAGGG(AAA -CAG)CCC-A GAUUG-U-AA -GU-UAA--- 3541 --UGU-UCuu aaaUAAU-A- GUGU-AGUG- ---------- ucaaaggca- uggagaaagu 3601 g-a------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- uguua-AUUG G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->AAAGU-A GGA(UUGGAA 3781 GC-G)-ACCA -UCUU|U(U- AA)A|GAAAG C(--GUAAAA )GC|-UCAC- CAAUUUGGC-GU-U -CU-CUA|-G CCAACAAU-- ---------- ---------- ----GUACAG 3961 GAACU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---caACAUU AU-------- ---------- ---------- ---------- 4081 -------|AC AGAA--ACU| A--C-AA|aa u--------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 auaac-)--- --------au -u-----GGU AGUAA-AA|- UG-UUCCGUA U---AAUUGU 4501 G--------A AGUUA-ACUC (aagaa--)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->GA GAU--AAU-G G|AGUU---| AUCGGAAUUA AGAAUGC-UG 4681 AU|AUGAGUA -AUG--uua- AUA-AG-GU- (uaag----- ---------- ---------- 4741 ---------- -----)-A-C CUUAU-|CAC U-GAAA-AUU AGA--AG-UU -|----uccu 4801 aauaaa-aag ---------- ----(--gua ag)c-u|gau uaggg----- ---------- 4861 ---uuacg-- -CGAUCGCUA A-G-A-U--- uaauau-(-g aca------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--aua--aa cu---A-UCG AU-GCGCAua uaga(----- ---------- ---------- 5041 ---------- --uuaauaau ----)ucuaa |---cg|uuu u--uauugua |gu<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- uuuaauu-GA Cauguguauu u--------- 5461 ---------- ---------- ---------- ---------- ---------- ---------- 5521 ---------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- uaaauaauua uauuauacuu acauuauaga uuauuugaaa 5641 uauaaguuuu aaaaauagau uaaaaca>aa auauCUGUAA ---AAA-gau a--<------ 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---uuuuaaa uaaaaa---- -AUCGUA|CU 6481 ---UAAACC- -(GACACU)G G|UUAAU-UG AUA-(GAA-U A-----)-UA UUAAAGUG-| 6541 |--UAGAA-U G--AAUGAUU -CUGA-AGGA ACUCGGCAAA AUAACU-CCG UAAC(UGCG- 6601 )GGAGAA-GG AGA|GCCuuu ---guu---- -----(guaa aa-)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->------ --aau--gaa 6781 -GGU|C(ACA )G--UAAAGA AGGGGUGG|C GA---CUG-U UU(AAUAA)A AA-CACA-GG 6841 AUUCUG|CA- -AAAUG---- ---------- (--GCAA--- ------)--- ---------- 6901 CAUGAUGUA- UAG-GGUCUG CGACCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-GU|G CUCCAA-GAG GAAGAG-GA- 7021 --GAACU--- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------g caa)-----G GUUU--GAAU U-GAAGUC-| 7141 UG-AGUA-AA C-|GG-C|-G -GCUGU-(AA CUAUG)ACGG UC|C(UAA)- GG-UAGCGAA 7201 AUU-CC-U-U |GUCGAG(-U AAUU-)UUCG AC|GC-GCAU GAAUGGUGUA A-CGACCUCC 7261 CC-------- ---------- -------ACU GUCUCCAGAA UCAC-UU-CG ----AUGAAA 7321 UU|G|AACUU UC-CG(U-GA AGAUG)CGGA AUA----UUA GCAGCUAGAC GGAAAG-ACC 7381 CUAUGC-|-A CCUUA--ACU UC|--A-CGC AUA--UAUU| <--------- ---------- 7441 ---------- ---------- --->GUGCA- AC-----AUU -UUUAAUUA- CGU---AGGA 7501 UACUUAUGa- -ugcuua-ug a-ucuuuugg --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> uuuuggccaa u)-uuaaa-g ga----ggcg 7681 -cuggUGAAA UAGUAAG|u- ---auAUUA- G-A-A-AAAU AGUA-Cuca- -a-------- 7741 -----(---- -aca)----- ---------- ---------- ---------- -------u<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->-GAU AAUGU-A-UG -CCG-GG-UA GUUUGACUG( 8161 GGG)CG-GU- A|ACCUUC(- --------UA AAGAGUAAC- )GAAG-GU|G |U|AUAA-|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->A-GG-UAA 8401 -AC|--UCA- AAAUAA<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (acugguuag )----UUAUU UG-------- ---------- 8701 ---------- ---------- ---------- ---GUGA|GU (G|UAAUG)G CAU-AAG-UU 8761 U-GC-UUGAC UGAAA-GAC( -cuacaa--- )GUCGA-UCA G--------- ---------- 8821 ---------- --------AG AC-------- ---(GCAA-- -)-------- ----GUC-GA 8881 U|---CAUAG UGAUC-CAAU AG-U------ ---------- UCU(------ ---------- 8941 ---------- ---------- ---------- ---------- ----GUGUGG AA)AG|GCUA 9001 UUGCU-AAC- |GGAUAAAAG GUACGC|UAG G|GAUAACAG |G-CUA-G-U CACAUAUUAG 9061 AG(U--UCAU )AUCUGUUAU --GUGGUUCG GC-ACCUCGA UGUC|GG--C U|U|AACAC| 9121 AU-CC-cGGA Gu-UG(--AA -AA)AGuUUC CaAG-GGU|U GGGG(UGUUC )ACCCA-UUA 9181 A--AGUGUU- --ACAUGAGC UGGGUUUAAA AC|GU-C(GU GA)GACAGUU UGGUCCCUAU 9241 CU|ACUGU-U AA|A|<---- ---------- ---------- ---------- ---------- 9301 >aacga-aaa aa-u-u-AAA AUC-CUU-CC UU--(UAGU- AC(-GAGA)G GACU-)GAGG 9361 U--GG-<--- ---------- ---------- -------->G UCGAUCA-CU GGUGUAUUAA 9421 U|-UAU-UAU (aaca-)<-- ---------- ---------- ---------- ---------- 9481 ---------- ---------- ---------- ---------- ---------- ---------> 9541 AUA-GUACCG UUAA--GUAG CUAC-AUCGA Aauauuaaua auauauagua uuauuaaGAG 9601 ---------- -AGAACUGCU (GAAAAA--A UAUUA)A-GU -AG-GAAACU UA-UUUU--- 9661 -agau--u-- -uuuuu-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ------(--- )--------- auaguca|GG 9961 UAA(AAGAUU A--)UUACUU U--------- ---------- ---------- ------GAUA 10021 G|GCUACAUA uagaaaugaa uaguaauaua auauaaaaau uugaaaaaau uuuuccauua 10081 auucuauaau uaaUGUGAUC UUA------- ---------- --------(- ---------- 10141 ---------- ------uuua u)UAAGA--- ---------- ---------- ---------- 10201 ----UUaGUA A|A|GUAGUA CUAAA-u--- ---------- ---------- ----auggau 10261 ---------- ---------- ---------- ---------- -----gacgu auuuuauuac 10321 u-------|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.D.dis.2 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Dictyostelium discoideum. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Dictyostelium discoideum. ORGANISM Mitochondria Dictyostelium discoideum. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: U21880 LOCUS DDU21880 1620 bp DNA INV 19-MAR-1995 DEFINITION Dictyostelium discoideum mitochondrion large subunit rRNA (rrn) gene, mitochondrial gene encoding mitochondrial rRNA, partial sequence. ACCESSION U21880 KEYWORDS . SOURCE slime mold. ORGANISM Mitochondrion Dictyostelium discoideum Eukaryotae; mitochondrial eukaryotes; Dictyosteliida; Dictyostelium. REFERENCE 1 (bases 1 to 1620) AUTHORS Wilczynska,Z., Barth,C. and Fisher,P.R. TITLE Partial genomic clone of Dictyostelium discoideum mitochondrial large subunit rRNA JOURNAL Unpublished REFERENCE 2 (bases 1 to 1620) AUTHORS Fisher,P.R. TITLE Direct Submission JOURNAL Submitted (28-FEB-1995) Paul R. Fisher, School of Microbiology, La Trobe University, Bundoora, Melbourne, Victoria 3083, Australia COMMENT NCBI gi: 717117 FEATURES Location/Qualifiers source 1..1620 /mitochondrion /strain="AX2" /organism="Dictyostelium discoideum" rRNA <1..>1620 /gene="rrn" /evidence=experimental /product="mitochondrial large subunit rRNA" BASE COUNT 580 a 225 c 342 g 473 t ORIGIN BASE COUNT 580 a 225 c 342 g 473 t 9155 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 301 |~~~~~~~~| ~~~~~~~~~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~(~~~~ 361 ~~~~~~~~~) ~|~~~~~~~~ ~~~~~~~|~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ 421 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~(~~~~ 481 )~~~|~~~~~ ~~(~~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~)~ 541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~<~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 601 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 661 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ |~~~~~~~~~ 841 ~~~(~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~(-~~ ~~)~~~~-~~ |~~~~~~~~~ ~~~~~~~(~~ ~~~~)~~~~~ ~~~~~~~~~~ 961 ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~>~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~< ~~~~~~~~~~ ~~~~~~~~~~ 1261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~)~~ ~~~~~~~~~~ ~~-|~(~~~) 1321 ~~~~~~~(~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ 1381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ >~~~~~~~~~ ~~~~~~(~~~ ~~~~~~~~~~ 1561 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~G G(GCCCA-C) -CCCCAA--A CUCAA-UAUA 1621 ---UGCUUAU U-UGACUGAU AGUG-AA--- -CAAGUACU( -GUGA-)AGG ---AAA-GA- 1681 UG-------- ---------- ---------- ---------- ---------- -------aaa 1741 aggaauauag a(aguua--) ucua------ ---------- ---uucAGUG AA--A-AGA- 1801 CCGUG-AAAU UGUA-AAC-A U-<------- ---------- ---------- ---------- 1861 ---ga>uaga gCAguuggag u-------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (------uaa 2041 --)------- gugacaac-G UACCUU(UU- GUAUA)AUGG |GUC-AGCGA GU-----UA- 2101 AUAAAUcgua gca-agcuua a-ggu--(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- -------agu a)----acua --uagg-cgc 2521 ag--(-GAAA )---cg<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->guau cu(uaaua-) -g-gugu--- --uca-gag- uac-A--UUA 2701 UUA-GA-CCG AA-AC-AA-G CG-AUCUAAU UAU-GAA-CA CGC-auu--- u-ua--uu-a 2761 u(-------- ---------- ---------- ---------- -----uuuu) auuuuaauuu 2821 G-GCGGAA-C CC-GUAACU( GUUGCAA-A) AGUU-UGGGA --UGAUUUG- UGAUUAG-GG 2881 GU(G-AAAG) GCU-AAUC-A A-GCUUGGUG AUAGCU-G-U UUUUU--ACG AA-AUC-UAU 2941 (-CUAG)GUA GA-AC-GGUG GUauaa AAU|-UUAUA 3061 G|AGGUAG|A GCACUGA-AU GG-Uuc--aa c-------(c uaag----)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ----gu---u 3301 AUU--AU-UU AAACUUCG-- AAUA|-cuau -a-a---aua ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -aauu-gA-C -CACU-AGGC AGACU--AU- GA-GC(-GCU 3481 AAG)GUCCAU AGgUC----U AAAGGG(AAA -CAG)CCC-A GAUUG-U-AA -GU-UAA--- 3541 --UGU-UCuu aaaUAAU-A- GUGU-AGUG- ---------- ucaaaggca- uggagaaagu 3601 g-a------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- uguua-AUUG G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->AAAGU-A GGA(UUGGAA 3781 GC-G)-ACCA -UCUU|U(U- AA)A|GAAAG C(--GUAAAA )GC|-UCAC- CAAUUUGGC-GU-U -CU-CUA|-G CCAACAAU-- ---------- ---------- ----GUACAG 3961 GAACU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---caACAUU AU-------- ---------- ---------- ---------- 4081 -------|AC AGAA--ACU| A--C-AA|aa u--------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 auaac-)--- --------au -u-----GGU AGUAA-AA|- UG-UUCCGUA U---AAUUGU 4501 G--------A AGUUA-ACUC (-aga---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->GA GAU---AU-G G|AGUU---| AUCGGAAUUA AGAAUGC-UG 4681 AU|AUGAGUA -AUG--uua- AUA-AG-GU- (uaag----- ---------- ---------- 4741 ---------- -----)-A-C CUUAU-|CAC U-GAAA-AUU AGG--AGGUU -|----uccu 4801 uauuaaaaag ---------- ----(--gua ag)c-u|gau uaggg----- ---------- 4861 ---uuacg-- -CGAUCGCUA A-G-A-U--- uaauau-(-g aca------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--aua--aa cu---A-UCG AU-GCGCAua uaga(----- ---------- ---------- 5041 ---------- --uuaauaau ----)ucuaa |---cg|uuu u-uuauugua |gu<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- uuuaauu-GA Cauguguauu u--------- 5461 ---------- ---------- ---------- ---------- ---------- ---------- 5521 ---------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- uaaauaauua uauuauacuu acauuauaga uuauuugaaa 5641 uauaaguuuu aaaaauagau uaaaaca>aa auauCUGUAA ---AAA-gau a--<------ 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---uuuuaaa uaaaaa---- -AUCGUA|CU 6481 ---UAAACC- -(GACACU)G G|UUAAU-UG AUA-(GAA-U A-----)-UA UUAAGGUG-| 6541 |--UAGAA-U G--AAUGAUU -CUGA-AGGA ACUCGGCAAA AUAACU-CCG UAAC(UGCG- 6601 )GGAGAA-GG AGA|GCCuuu ---guu---- -----(guaa aa-)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->------ --aau--gaa 6781 -GGU|C(ACA )G--UAAAGA AGGGGUGG|C GA---CUG-U UU(AAUAA)A AA-CACA-GG 6841 AUUCUG|CA- -AAAUG---- ---------- (--GCAA--- ------)--- ---------- 6901 CAUGAUGUA- UAG-GGUCUG CGACCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-GU|G CUCCAA-GAG GAAGAG-GA- 7021 --GAACU--- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------g caa)-----G GUUU--GAAU U-GAAGUC-| 7141 UG-AGUA-AA C-|GG-C|-- -GCUGU-(AA CUAUG)ACGG UC|C(UAA)- GG-UAGCGAA 7201 AUU-CC-U-U |GUCGAG(-U AAUU-)UUCG AC|GC-GCAU GAAUGGUGUG AACGACCUCC 7261 CC-------- ---------- -------ACU GUCUCCAGAA UCAC-UU-CG ----AUGAAA 7321 UU|G|AAC-U UC-CG(U-GA AGAUG)CGGA AUAuuucaUA GCAGCCUGAC GGA-AG-A-C 7381 CUAUGC-|-A CCUUA--ACU UC|--A-CGC A~~~~~~~~| <~~~~~~~~~ ~~~~~~~~~~ 7441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~>~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> ~~(~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ 7681 ~~~~~~~~~~ ~~~~~~~|~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7741 ~~~~~(~~~~ ~~~~)~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~<~ 7801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~>~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( 8161 ~~~)~~~~~~ ~|~~~~~~(~ ~~~~~~~~~~ ~~~~~~~~~~ )~~~~~~~|~ |~|~~~~-|< 8221 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8281 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8341 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~>~~~~~~~~ 8401 ~~~|~~~~~~ ~~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8461 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8521 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8581 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8641 ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8701 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~|~~ (~|~~~~~)~ ~~~~~~~~~~ 8761 ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8821 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~(~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ 8881 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~(~~~~~~ ~~~~~~~~~~ 8941 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~)~~|~~~~ 9001 ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~|~~~ ~|~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 9061 ~~(~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~|~~~~~~~| 9121 ~~~~~~~~~~ ~~~~~(~~~~ ~~~)~~~~~~ ~~~~~~~~|~ ~~~~(~~~~~ )~~~~~~~~~ 9181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~|~~~~(~~ ~~)~~~~~~~ ~~~~~~~~~~ 9241 ~~|~~~~~~~ ~~|~|<~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9301 >~~~~~~~~~ ~~-~~~~~~~ ~~~-~~~~~~ ~~~~(~~~~~ ~~(~~~~~)~ ~~~~~)~~~~ 9361 ~~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~-~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (2)-EUGLEN 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.T.borre 10775 bp RNA RNA 14-APR-1995 DEFINITION Kinetoplast Trypanoplasma borreli.; Putative cryptogene, G-rich region; Cytochrome C oxidase subunit III; Large subunit ribosomal RNA; 5' pre-edited region of CYb mRNA; 3' pre-edited region of CYb mRNA; Pre-edited region of pan-edited mRNA for RPS12; apocytochrome b, non-edited part of mRNA. ACCESSION U14181 KEYWORDS Putative cryptogene, G-rich region; Cytochrome C oxidase subunit III; Large subunit ribosomal RNA; 5' pre-edited region of CYb mRNA; 3' pre-edited region of CYb mRNA; Pre-edited region of pan-edited mRNA for RPS12; apocytochrome b, non-edited part of mRNA. SOURCE Kinetoplast Trypanoplasma borreli. ORGANISM Kinetoplast Trypanoplasma borreli. REFERENCE 1 (bases 1 to 4348) AUTHORS Maslov,D.A. and Simpson,L. TITLE cryptobiid kinetoplastid protozoan Trypanoplasma borreli RNA editing and mitochondrial genomic organization in the JOURNAL Mol. Cell. Biol. 14 (12), 8174-8182 (1994) STANDARD No information REFERENCE 2 (bases 1 to 4348) AUTHORS Maslov,D.A. TITLE Direct Submission JOURNAL Submitted (31-AUG-1994) Dmitri A. Maslov, Biology, University of California at Los Angeles, 405 Hilgard Ave, Los Angeles, CA 90024-1606, USA STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: U14181 BASE COUNT 482 a 115 c 70 g 634 t 9474 others ORIGIN 1 |~~~~~~~~~ gaaaauuuga uaacauuuuu auuuuacuau uucuguauuu uaacuuauua 61 uauuaauuua accuuuaaaa uuuuuaucuu aaaauuuuau aaacuuuacu ucuuaaaaaa 121 uauauuuaaa uuuaaauuuu ggaguuuuuu uuaaucacua auauuuucua auuuuauauu 181 uuuauuuu-- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 |--------| ---------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ---------- |--------- 841 ---(----)- ---------- ---------- ---------- ---------- ---------- 901 ------(--- --)------- |--------- -------(-- ----)----- ---------- 961 -------<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- ---------- ---------- ---------( ------)--- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 ---------- ---------- --<------- ---------- ---------- ---------- 1861 ----->---- ---------- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--------- 2041 --)------- ---------- ------(--- -----)---- |--------- ---------- 2101 ---------- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )--------- --(------) ---------- ---------- ---------- 2701 ---------- ---------- ---uuaauua uuu-aca-ac uuu------- ---------- 2761 -(-------- ---------- ---------- ---------- -----uaaa) ---------- 2821 --aaau-A-C UG-UAUAUA( GUUACAA-U) UAUUA-CACU --uaaaaau- uuaauuc-cu 2881 uu(u-acau) agc------- ---------- ---------- ---------- ---------- 2941 ---------- ---------- ------ ---------- 3061 --------|- ---------- ---------- ---------- ---------< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- -<-------- ---------- ---------a 3721 aacuaacaac uuaauuuuau a-cuauua-a aauaacuugu au>uaauu-u cau(auaaa- 3781 -u-u)-uuga -uuuu|u(u- ug)-|cuauu u(--uuuaaa )aa|-aau-- ------<--- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 ->-------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|-- ---------| -------|-- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ---------- ---------- --------|- ---------- ---------- 4501 ---------- ---------- (-------)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- -|-------| ---------- ---------- 4681 --|------- ---------- ---------- (--------- ---------- ---------- 4741 ---------- -----)---- ------|--- ---------- ---------- -|-------- 4801 ---------- ---------- ----(----- --)---|--- ---------- ---------- 4861 ---------- ---------- ---------- -------(-- ---------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--------- ---------- ---------- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- ---------- 6481 ---------- ---------- ---------- ---------- ---------- ---------- 6541 -uuuauuuau auacacuuuu -uuau-uaa- ---------- ---------- ---------- 6601 ---------- ---------- ---------- ---------- ----<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------u uuauucauaa aaa>------ ---------- 6781 ------(--- )--------- uauuuaaa|u cc---aAG-U UU(AUUUA)A UG-CUUu-uc 6841 uauuug|--- ---------- ---------- (-uaauuua- ------)--- ---------- 6901 ---------- uaaauuuuu- uuuugu- --------|- ---------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------- ---)------ ---------- ---------| 7141 ---------- --|----|-- -------(-- -----)---- --|U(AUU)- UG-UAGCUAA 7201 AUA-AU-U-U |AUUAGC(-U AAUU-)ACUA AC|UU-guuc ca--cuaa-u u-aauauuua 7261 u--------- ---------- -------au- -auauuauac uauu-au-ac auu-aaauaa 7321 cu|a|auacg ua-uu(u--a aua-u)aaua uuu----AUA CAUGUUAAAG GGCAAG-UCC 7381 UUU-UU-|-U ACUUU--ACA UU|--U-AAU UUU--A---| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<--aaauu uucauauuau aaau------ 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- ---UA-A-AA -AUU-GU-AU GUUUGGUUG( 8161 GGA)UA-ACA U|AAUAUC(- --------UU AUUAUAUUA- )UUUA-AA|a |a|uaga-|< 8221 ucuuaauuau uagca----- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ---------- ---------( ---------- )--------- ---------- ---------- 8821 ---------- ---------- ---------- ---(------ -)-------- ---------- 8881 -|-------- ---------- ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- ---------- --)--|---- 9001 --------a- |uUAUAUAAG UCUUAA|AAA G|GUUAACAA |G-CAU-a-c ---------- 9061 --(u-uugua )--------- -----uaAAU GU-GUUUCUU CGUC|UA--C U|U|AUGUA| 9121 uuauu-aauu a----(-uua aua)---uac uu---aaa|A AAGU(UGUUC )ACUUU-ucu 9181 a---UACAU- --UCAUUAGU UGGGUUAAAA UC|GU-U(GU AA)AGCAGAU UUUUUAAUAU 9241 UU|ACUUA-U UU|U|<---- ---------- ---------- ------ucuu cuuacaaac- 9301 >--------- ---------- ----ucc-gu acu-(UAGU- AC(-GAGA)G GACU-)auau 9361 u--uu-- ---------- ---------- 9421 -|-------- (-----) 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.C.oncop 10775 bp RNA RNA 11-JAN-191 DEFINITION Kinetoplast Crithidia oncopelti. ACCESSION No information KEYWORDS No information. SOURCE Kinetoplast Crithidia oncopelti. ORGANISM Kinetoplast Crithidia oncopelti. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: X51736 ID MICO12SR standard; DNA; ORG; 1200 BP. XX AC X51736; XX DT 25-FEB-1991 (Rel. 27; Last updated; Version 3) DT 05-JUN-1990 (Rel. 24; Created) XX DE Crithidia oncopelti kinetoplast 12S ribosomal RNA XX KW 12S ribosomal RNA; ribosomal RNA. XX OS Crithidia oncopelti OC Eukaryota; Animalia; Protozoa; Sarcomastigophora; Mastigophora; OC Kinetoplastida; Trypanosomatina; Trypanosomatidae. XX OG Kinetoplast XX RN [1] RB 1-1200 RA Maslov D.A.; RT ; RL Submitted (16-FEB-1990) to the EMBL Data Library by: RL Maslov D.A., Dept. of Mol. Bio., Faculty of Biology, M. V. RL Lomonosov State University, 119899 Moscow, U S S R. XX RN [2] RB 1-1200 RA Horvath A., Maslov D.A., Kolesnikov A.A.; RT "The nucleotide sequence of the 12S ribosomal RNA gene from RT kinetoplast DNA of the protozoan Crithidia oncopelti."; RL Nucleic Acids Res. 18:2811-2811(1990). XX CC *source: strain=S-068; XX FH Key Location/Qualifiers FH FT rRNA 57..1180 FT /note="12S ribosomal RNA" XX SQ Sequence 1200 BP; 502 A; 85 C; 109 G; 504 T; 0 other; BASE COUNT 473 a 82 c 101 g 468 t 9651 others ORIGIN 1 |~~~~~~~~~ aauuaaucau auuuuauaaa uuuauaguaa agaaguauua uuauauuuau 61 uauuuauauu uuguauuuua auuuauuuaa acauuuauag uauaaauugu uauauauuua 121 aauuuuaaau uuguuguuuu auauuuaguu ucauauuuua guuauaauaa ccaaucauau 181 c--------- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 |--------| ---------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ---------- |--------- 841 ---(----)- ---------- ---------- ---------- ---------- ---------- 901 ------(--- --)------- |--------- -------(-- ----)----- ---------- 961 -------<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- ---------- ---------- ---------( ------)--- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 ---------- ---------- --<------- ---------- ---------- ---------- 1861 ----->---- ---------- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--------- 2041 --)------- ---------- ------(--- -----)---- |--------- ---------- 2101 ---------- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->---- --(------) ---------- ---------- ---------- 2701 --a-aaaucu -a-aaauu-u au-ugAACUG UUA-UAA-AU AGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----uuauu) ---------- 2821 --AUUU-U-U UG-UUUAAU( GUUUAAA-U) AUUUaACUA- --UUAAAGU- UACAGUU-Gu 2881 uc(u-auau) gua-ccua-a u-aaaaauag uaagauaauu u--------- ---------- 2941 ---------- ---------- ------ ---------- 3061 --------|- ---------- ---------- ---------- ---------< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- -<-------- ---------- ---------a 3721 auuaaaaaau aauuauuca- ---gcaauca aaugaauauu au>gaaaa-a ucu(aaaaa- 3781 -u-u)-aaau -uauu|-(-- -c)-|ugcua a(--aaaaua )aa|-uaa-- ------<--- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 ->-------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|-- ---------| -------|-- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ---------- ---------- --------|- ---------- ---------- 4501 ---------- ---------- (-------)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- -|-------| ---------- ---------- 4681 --|------- ---------- ---------- (--------- ---------- ---------- 4741 ---------- -----)---- ------|--- ---------- ---------- -|-------- 4801 ---------- ---------- ----(----- --)---|--- ---------- ---------- 4861 ---------- ---------- ---------- -------(-- ---------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--------- ---------- ---------- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- ---------- 6481 ---------- ---------- ---------- ---------- ---------- ---------- 6541 -uuuuuuaaa aauauauaua -uguu-guu- ---------- ---------- ---------- 6601 ---------- ---------- ---------- ---------- ----<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- aauaaauuuu uaa>------ ---------- 6781 ------(--- )--------- -UAUUUUA|A AA---GCG-U UU(AUUAA)A UG-CGUU-CG 6841 UCUAAG|--- ---------- ---------- (-auuauua- ------)--- ---------- 6901 ---------- UUUAAGAUU- aUUCUA- --------|- ---------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------- ---)------ ---------- ---------| 7141 ---------- --|----|-- -------(-- -----)---- --|U(UUU)- AG-UAGCAUA 7201 AUA-AU-U-U |GUUAAC(-U AAUU-)AUUA AA|GU-guuc ca-uAGAA-A A-UUUUGAAG 7261 UU-------- ---------- -------Aa- -aacaaacaa aaua-ac-ca au--aaauua 7321 aa|a|uaaaa au-uu(u--a aua-a)aaau uaA----AAA AUUAAAAUAG GGCAAG-UCC 7381 UAC-UC-|-U CCUUU--ACA AA|--G-AGA ACA--U---| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<---uuaa u--------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- ---AU-G-UA -AUU-GU-AU GUUUGAUUG( 8161 GGG)CA-AUA C|UAUAUC(- --------UA UUUAUAUAG- )AAAA-AG|a |-|-----|< 8221 acuauaauaa uugaa----- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ---------- ---------( ---------- )--------- ---------- ---------- 8821 ---------- ---------- ---------- ---(------ -)-------- ---------- 8881 -|-------- ---------- ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- ---------- --)--|---- 9001 --------a- |uAAUAAAAG GUUCGA|GCA G|GUUAACAA |G-CAU-U-A ---------- 9061 --(U--UAC- )--------- -----UAAAU GU-GUUUCAU CGUC|UA--C U|U|AUUGC| 9121 u--------- -----(---u aa-)------ -------a|U UGAU(UGUUC )AUCAA-aau 9181 u---GCAAU- --UCGUUAGU UGGGUUAAAA UC|GU-U(GU AA)AGCAGAU UUGUUUAUAU 9241 AU|UUAAU-U UG|U|<---- ---------- ---------- ------auua aaaguuaaa- 9301 >--------- ---------- ----AUC-AA AAU-(UAGU- AC(-GCAA)G GAUC-)UUUU 9361 ---AU-<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.C.fasci 10775 bp RNA RNA ~?~???? DEFINITION Kinetoplast Crithidia fasciculata. ACCESSION No information KEYWORDS No information. SOURCE Kinetoplast Crithidia fasciculata. ORGANISM Kinetoplast Crithidia fasciculata. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Organism information Culture collection: ? Sequence information (bases 1 to 10775) Corresponding GenBank entry: X02548 Phylo:Mitochondria,Kinetoplast,Crithidia BASE COUNT 462 a 74 c 110 g 495 t 9634 others ORIGIN 1 |~~~~~~~~~ uuuaucauuu auauuaaaaa auaauaaggu cgcuauauau uguaa--aag 61 uguuaauuua aauuuugauu auguuuuuau uuaauuuuau uuauacauau uaauuauaau 121 auauuuaaau auuaaauuug uuguuuuaua uuuaguuuaa aauuuaauau auaauuauaa 181 acaauugu-- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 |--------| ---------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ---------- |--------- 841 ---(----)- ---------- ---------- ---------- ---------- ---------- 901 ------(--- --)------- |--------- -------(-- ----)----- ---------- 961 -------<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- ---------- ---------- ---------( ------)--- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 ---------- ---------- --<------- ---------- ---------- ---------- 1861 ----->---- ---------- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--------- 2041 --)------- ---------- ------(--- -----)---- |--------- ---------- 2101 ---------- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->---- --(------) ---------- ---------- ---------- 2701 -----cauuu aa-aguuu-u aa-ugAACUG UUA-UUU-AU AGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----ugaua) ---------- 2821 --UUUU-U-U AG-UUUAAU( GUUUAAA-U) AUUUaUCUA- --AUAAUGU- UACAGUU-Gu 2881 uc(u-auau) gua-ccaa-u a-agaaauag uaaaauuauu u--------- ---------- 2941 ---------- ---------- ------ ---------- 3061 --------|- ---------- ---------- ---------- ---------< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- -<-------- ---------- ---------a 3721 uuuaauaaau aguuauuuga a-uauuauau uacaaauauu au>gaagu-u uuu(aaaaa- 3781 -u-u)-aaau -uuuu|a(a- uc)-|uauua u(--aauaua )au|-uug-- ------<--- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 ->-------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|-- ---------| -------|-- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ---------- ---------- --------|- ---------- ---------- 4501 ---------- ---------- (-------)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- -|-------| ---------- ---------- 4681 --|------- ---------- ---------- (--------- ---------- ---------- 4741 ---------- -----)---- ------|--- ---------- ---------- -|-------- 4801 ---------- ---------- ----(----- --)---|--- ---------- ---------- 4861 ---------- ---------- ---------- -------(-- ---------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--------- ---------- ---------- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- ---------- 6481 ---------- ---------- ---------- ---------- ---------- ---------- 6541 -auuuuuaaa aauacauaua -uauu-guu- ---------- ---------- ---------- 6601 ---------- ---------- ---------- ---------- ----<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- aauaaaauua uua>------ ---------- 6781 ------(--- )--------- -AGUUUCA|A AA---GCG-U UU(AUUAA)A UG-CGCU-UG 6841 UCUAAG|--- ---------- ---------- (-uuuuuua- ------)--- ---------- 6901 ---------- UUUAAGAUA- aUUCUU- --------|- ---------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------- ---)------ ---------- ---------| 7141 ---------- --|----|-- -------(-- -----)---- --|U(AUA)- AG-UAGCAUA 7201 GUA-AU-U-U |GUUAAC(-U AAUU-)AUUA AA|AU-guuc ca-cAGAA-A A-UUUUAAAA 7261 UU-------- ---------- -------Au- -aacaaucaa agua-aa-ua au--aaauua 7321 aa|a|uaaaa au-uu(u--a aaa-a)aaau uaA----AAA AUUAAAAUAG GGCAAG-UCC 7381 UAC-UC-|-U CCUUU--ACA AA|--G-AGA ACA--U---| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<-auuuaa u--------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- ---AU-G-UA -AUU-GU-AU GUUUGAUUG( 8161 GGG)CA-AUA C|UAUAUC(- --------UU AUUAUAUAG- )AAAA-AG|a |-|-----|< 8221 acuauacuua uugaa----- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ---------- ---------( ---------- )--------- ---------- ---------- 8821 ---------- ---------- ---------- ---(------ -)-------- ---------- 8881 -|-------- ---------- ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- ---------- --)--|---- 9001 --------a- |uAAUAAAAG GUUCGA|GCA G|GUUAACAA |G-CAU-U-A ---------- 9061 --(A--UAC- )--------- -----UAAAU GU-GUUUCAU CGUC|UA--C U|U|AUUGC| 9121 u--------- -----(--aa aaa)------ -------a|U UGAU(UGUUC )AUCAA-aaa 9181 u---GCAAU- --UCGUUAGU UGGGUUAAAA UC|GU-U(GU AA)AGCAGAU UUGUUUAUAU 9241 AU|UUAAU-U AG|U|<---- ---------- ---------- ------uaau uuaauuaagu 9301 >--------- ---------- ----UUU-AA UAg-(UAGU- AC(-GCAA)G GAUU-)UAUU 9361 A--U~-<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.H.maria 10775 bp RNA RNA 11-JUN-1994 DEFINITION Kinetoplast Herpetomonas mariadeanei.; . ACCESSION U01009 KEYWORDS . SOURCE Kinetoplast Herpetomonas mariadeanei. ORGANISM Kinetoplast Herpetomonas mariadeanei. REFERENCE 1 (bases 1 to 1024) AUTHORS Landweber,L.F. and Gilbert,W. TITLE phenomenon Phylogenetic analysis of RNA editing: a primitive genetic JOURNAL Proc. Natl. Acad. Sci. U.S.A. 91, 918-921 (1994) STANDARD No information REFERENCE 2 (bases 1 to 1024) AUTHORS Landweber,L. TITLE Direct Submission JOURNAL Submitted (23-AUG-1993) Laura Landweber, Cellular and Developmental Biology, Harvard University, Biological Laboratories, 16 Divinity Ave., Cambridge, Massachusetts 02138, USA STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: U01009 BASE COUNT 455 a 85 c 94 g 385 t 9756 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~u guuguuuuau auuuaguuua auauauuuuu aaaauauuaa cacaugauau 181 annnnnaagu ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 |--------| ---------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ---------- |--------- 841 ---(----)- ---------- ---------- ---------- ---------- ---------- 901 ------(--- --)------- |--------- -------(-- ----)----- ---------- 961 -------<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- ---------- ---------- ---------( ------)--- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 ---------- ---------- --<------- ---------- ---------- ---------- 1861 ----->---- ---------- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--------- 2041 --)------- ---------- ------(--- -----)---- |--------- ---------- 2101 ---------- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->---- --(------) ---------- ---------- ---------- 2701 ------aucu aa-aauuu-c u--ugAACUG UUA-UUU-AU AGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----uuuau) ---------- 2821 --AUUU-U-U UA-UUUAAU( GUUUAAA-U) AUUUaAUUAu ugAUGcuau- cACAGUU-gu 2881 uu(u-auau) guc-ccua-a c-aaaaauag uaa-gagccu u--------- ---------- 2941 ---------- ---------- ------ ---------- 3061 --------|- ---------- ---------- ---------- ---------< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- -<-------- ---------- ---------a 3721 auuaauaaau aauuauu--- caaauaauau uaugaauauu au>gaaaa-u uau(aaaaa- 3781 -u-u)-aua- -auau|a(u- aa)u|ccaau a---auaugu -au--uacua aaa------- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 ---------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 ---------- ---------| ---------- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- ---------- ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ---------- ---------- ---------| ---------- ---------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- --)------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---|------ ---------- ---------- ---------- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 ---------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ---------- ---------- ---------- ----ua-uau 5701 ----uu---- aauugaauau uaaaaguacc aauuuaauuu g-aaauuuau aacaaauaua 5761 cguuuuaauu auggaauuaa aauaaaaa-- ----gaauaa -a-aa-uauu uuaauauuua 5821 auauuuguua accaaaaagu aac-cauaaa gaa---uaau aaguauua-- -uuauuaaaa 5881 auauaauua- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---------- ---------- ---------- 6481 ---------- ---------- ---------- ---------- ---------- ---------- 6541 ------uaaa aauacaaaaa -uauu-guu- ---------- ---------- ---------- 6601 ---------- ---------- ---------- ---------- ----<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- aauaaaauua uca>------ ---------- 6781 ------(--- )--------- -AAUUUCA|A AA---GCA-U UU(AUUAA)A UG-UGCC-UG 6841 UCUAAG|--- ---------- ---------- (-uaaaaua- ------)--- ---------- 6901 ---------- UUUAAGAUA- aUUCUU- --------|- ---------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------- ---)------ ---------- ---------| 7141 ---------- --|----|-- -------(-- -----)---- --|U(AUC)A AG-UAGCAUA 7201 GUA-AU-U-U |GUUAAC(-U AAUU-)AUUA AA|GU-guuc ca-uAGAA-A A-UUUUAAAA 7261 UU-------- ---------- -------Aa- -aacaaacaa cgua-ac-ua au--aaauua 7321 aa|a|uaaag au-uu(u--a aua-a)aaac caA----AAA AUUAAAAUAG GGCAAG--CC 7381 UAC-UC-|-U CCUUU--ACA AA|--G-AGA ACA--U---| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<-aaau-a u--------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- ---AU-G-UA -AUU-GU-AU GUUUGAUUG( 8161 GGG)CA-AUA C|UAUAUC(- --------UA AAUAUAUAG- )AAAA-AG|a |-|-----|< 8221 gcuauaauua uugaa----- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ---------- ---------( ---------- )--------- ---------- ---------- 8821 ---------- ---------- ---------- ---(------ -)-------- ---------- 8881 -|-------- ---------- ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- ---------- --)--|---- 9001 --------a- |uAAUAAAAG GUUCGA|GCA G|GUUAACAA |G-CAU-U-A ---------- 9061 --(A--AAC- )--------- -----UAAAU GU-GUUUCAU CGUC|UA--C U|U|AUUAC| 9121 u--------- -----(-aau aaa)------ -------a|U UGAU(UGUUC )AUCAA-aau 9181 u---GUAAU- --UCGUUAGU UGGGUUAAAA UC|GU-U(GU AA)AGCAGAU UUGUUUAUAU 9241 AU|UUAAU-U AU|A|<---- ---------- ---------- ------aaau aauauuaaaa 9301 >--------- ---------- ----UCA-AA -Au-(UAGU- AC(-GCAA)G GAUC-)U-uu 9361 a--u~-<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.H.musca 10775 bp RNA RNA 29-JUN-1994 DEFINITION Kinetoplast Herpetomonas muscarum.; . ACCESSION U01011 KEYWORDS . SOURCE Kinetoplast Herpetomonas muscarum. ORGANISM Kinetoplast Herpetomonas muscarum. REFERENCE 1 (bases 1 to 1004) AUTHORS Landweber,L.F. and Gilbert,W. TITLE Phylogenetic analysis of RNA editing: a primitive genetic phenomenon JOURNAL Proc. Natl. Acad. Sci. U.S.A. 91, 918-921 (1994) STANDARD No information REFERENCE 2 (bases 1 to 1004) AUTHORS Landweber,L. TITLE Direct Submission JOURNAL Submitted (23-AUG-1993) Laura Landweber, Cellular and Developmental Biology, Harvard University, Biological Laboratories, 16 Divinity Ave., Cambridge, MA 02138, USA STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: U01011 BASE COUNT 441 a 75 c 103 g 380 t 9776 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ uguuguuuua uauuuaguuu unnnuuuaua annaacaaaa 181 uuuaaaauaa ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 |--------| ---------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ---------- |--------- 841 ---(----)- ---------- ---------- ---------- ---------- ---------- 901 ------(--- --)------- |--------- -------(-- ----)----- ---------- 961 -------<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- ---------- ---------- ---------( ------)--- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 ---------- ---------- --<------- ---------- ---------- ---------- 1861 ----->---- ---------- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--------- 2041 --)------- ---------- ------(--- -----)---- |--------- ---------- 2101 ---------- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->---- --(------) ---------- ---------- ---------- 2701 -----aauuu aa-aguuu-c u--ugAACUG UUA-UAU-AU AGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----uuaua) ---------- 2821 --UUUU-A-U AG-UUUAAU( GUUUAAA-U) AUUUaAUUA- --AUGAUGAG GACAGUU-Gu 2881 uc(u-auau) gua-ccaa-a g-aaaaauag uaaaauaau- g--------- ---------- 2941 ---------- ---------- ------ ---------- 3061 --------|- ---------- ---------- ---------- ---------- ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------a 3721 auuaauaaau aauuauuuau a-uaa---aa aauaaauauu au>gaaaa-a uau(aaaaa- 3781 -u-u)-aua- --uuu|u(g- ua)a|gccaa u---aauaau ---------- ---------- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 ---------- ---------- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 ---------- ---------- ---------- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- ---------- ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ---------- ---------- ---------- ---------- ---------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- --)------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---------- ---------- ---------- ---------- 5521 ---------- ---------- ---------- ---------- ---------- ---------- 5581 ---------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ---------- ---------- ---------- ------aaau 5701 aaaaauaaac aauuuuaauu gaauauuaaa auuacaaauu uaauuuguac uuaguaaaau 5761 auauuaaaau acugguauau auauauag-- ----c-auaa u----g---u uuaauauuua 5821 auauuuguua aauaaaaagu aac-caaaau aaa---uuaa aagaauuauu guuauauaua 5881 u--------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---------- ---------- ---------- 6481 ---------- ---------- ---------- ---------- ---------- ---------- 6541 -auuuuuaaa aauacaaaua -uguu-guu- ---------- ---------- ---------- 6601 ---------- ---------- ---------- ---------- ----<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- aauaaaauua uca>------ ---------- 6781 ------(--- )--------- -AAUUUUA|A AU---GCG-U UU(AUUAA)A UG-CGCU-CG 6841 UCUAAG|--- ---------- ---------- (-aauaaua- ------)--- ---------- 6901 ---------- UUUAAGACU- aUUCUG- --------|- ---------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------- ---)------ ---------- ---------| 7141 ---------- --|----|-- -------(-- -----)---- --|U(AUU)- AG-UAGCAUA 7201 GUA-AU-U-U |GUUAAC(-U AAUU-)AUUA AA|GU-guuc ca-uAGAA-A A-UUUUAAAA 7261 UU-------- ---------- -------Aa- -aacaaacaa agua-au-ua au--aaauua 7321 aa|a|uaaag au-uu(u--a aua-a)aaau caA----AAA AUUAAAAUAG GGCAAG-UCC 7381 UAC-UC-|-U CCUUU--ACA AA|--G-AGA ACA--U---| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<-uaa--a u--------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- ---AU-G-UA -AUU-GU-AU GUUUGAUUG( 8161 GGG)CA-AUA C|UAUAUC(- --------UA GUUAUAUAG- )CAAA-AG|a |-|-----|< 8221 acuauaauua uugaa----- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ---------- ---------( ---------- )--------- ---------- ---------- 8821 ---------- ---------- ---------- ---(------ -)-------- ---------- 8881 -|-------- ---------- ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- ---------- --)--|---- 9001 --------a- |uAAUAAAAG GUUCGA|GCA G|GUUAACAA |G-CAU-U-A ---------- 9061 --(A--AAC- )--------- -----UAAAU GU-GUUUCAU CGUC|UA--C U|U|AUUGC| 9121 u--------- -----(-aa- -aa)------ -------a|U UGAU(UGUUC )AUCAA-aau 9181 u---GCAAU- --UCGUUAGU UGGGUU-AAA UC|GU-U(GU AA)AGCAGAU UUGUUUAUAU 9241 AU|UUAAG-U UU|-|<---- ---------- ---------- ----auauaa aaguuucaga 9301 >--------- ---------- ------u-aa acaa(CAGU- AC(-GCAA)G GAUgc)auuu 9361 a--u~-<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.H.samue 10775 bp RNA RNA 11-JUN-1994 DEFINITION Kinetoplast Herpetomonas samuelpessoai.; . ACCESSION U01012 KEYWORDS . SOURCE Kinetoplast Herpetomonas samuelpessoai. ORGANISM Kinetoplast Herpetomonas samuelpessoai. REFERENCE 1 (bases 1 to 1011) AUTHORS Landweber,L.F. and Gilbert,W. TITLE Phylogenetic analysis of RNA editing: a primitive genetic phenomenon JOURNAL Proc. Natl. Acad. Sci. U.S.A. 91, 918-921 (1994) STANDARD No information REFERENCE 2 (bases 1 to 1011) AUTHORS Landweber,L. TITLE Direct Submission JOURNAL Submitted (23-AUG-1993) Laura Landweber, Cellular and Developmental Biology, Harvard University, Biological Laboratories, 16 Divinity Ave., Cambridge, MA 02138, USA STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: U01012 BASE COUNT 438 a 73 c 101 g 396 t 9767 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ uguuguuuua uauuuaguuu aannnuuauu aaauuaggcc 181 aauuaauaau aauu------ ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 |--------| ---------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ---------- |--------- 841 ---(----)- ---------- ---------- ---------- ---------- ---------- 901 ------(--- --)------- |--------- -------(-- ----)----- ---------- 961 -------<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- ---------- ---------- ---------( ------)--- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 ---------- ---------- --<------- ---------- ---------- ---------- 1861 ----->---- ---------- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--------- 2041 --)------- ---------- ------(--- -----)---- |--------- ---------- 2101 ---------- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->---- --(------) ---------- ---------- ---------- 2701 -------uuu aa-aguuu-c u--ugAACUG UUA-UAU-AU AGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----uuuuu) ---------- 2821 --AUUA-A-U AG-UUUAAU( GUUUAAA-U) AUUUaACUA- --AUGAUGAA AACAGUU-gu 2881 uc(u-auau) gua-ccaa-a g-aaauauag uaaaauaau- g--------- ---------- 2941 ---------- ---------- ------ ---------- 3061 --------|- ---------- ---------- ---------- ---------- ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------a 3721 uuuaauaaau aauuauu-ca a-auca-uaa aaugaauauu au>gaaaa-a uau(aaaaa- 3781 -u-u)-auau -guuu|u(aa ac)c|aauag u--auaaaua -aa--auaaa a--------- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 ---------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 ---------- ---------| ---------- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- ---------- ---------- ---------- ---------- 4501 ---------- ---------- ---------- ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ---------- ---------- ---------| ---------- ---------- 4681 ---------- ---------- ---------- ---------- ---------- ---------- 4741 ---------- ---------- ---------- ---------- ---------- ---------- 4801 ---------- ---------- ---------- --)------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---|------ ---------- ---------- ---------- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 ---------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ---------- ---------- ---------- ----ua-u-- 5701 --uuuu---- aauugaauau uaaaaauaca aauuu---ua ---auu-ugu ac-u-uagua 5761 a-aaaaauaa uaaguuuggu aguaaaauaa aucaaaauaa ----auuauu uuaauauuua 5821 auauuuguua aauaaaaagu aac-uaaaua aau---uuau aagaauuauu auugcuaaua 5881 uauuuuuaaa aauauc---- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---------- ---------- ---------- 6481 ---------- ---------- ---------- ---------- ---------- ---------- 6541 ---------- -----aaaua -uguu-guu- ---------- ---------- ---------- 6601 ---------- ---------- ---------- ---------- ----<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- aauaaaauua uca>------ ---------- 6781 ------(--- )--------- -AAUUUUA|A AU---GCG-U UU(AUUAA)A UG-CGCU-CG 6841 UCUAAG|--- ---------- ---------- (-aauuuua- ------)--- ---------- 6901 ---------- UUUAAGAUU- aUUCUG- --------|- ---------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------- ---)------ ---------- ---------| 7141 ---------- --|----|-- -------(-- -----)---- --|U(AUU)- AG-UAGCAUA 7201 GUA-AU-U-U |GUUAAC(-U AAUU-)AUUA AA|GU-guuc ca-uAGAA-A A-UUUUAAAA 7261 UU-------- ---------- -------Aa- -aacaaacaa agua-au-ua au--aaauua 7321 aa|a|uaaag au-uu(u--a aua-a)aaau caA----AAA AUUAAAAUAG GGCAAG-UCC 7381 UAC-UC-|-U CCUUU--ACA AA|--G-AGA ACA--U---| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<-uuu--a u--------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- ---AU-G-UA -AUU-GU-AU GUUUGAUUG( 8161 GGG)CA-AUA C|UAUAUC(- --------UU GUUAUAUAG- )AAAA-AG|a |-|-----|< 8221 acuauaauca uugaa----- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ---------- ---------( ---------- )--------- ---------- ---------- 8821 ---------- ---------- ---------- ---(------ -)-------- ---------- 8881 -|-------- ---------- ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- ---------- --)--|---- 9001 --------a- |uAAUAAAAG GUUCGA|GCA G|GUUAACAA |G-CAU-U-A ---------- 9061 --(A--AAC- )--------- -----UAAAU GU-GUUUCAU CGUC|UA--C U|U|AUUGC| 9121 u--------- -----(-aa- -aa)------ -------a|U UGAU(UGUUC )AUCAA-aau 9181 u---GCAAU- --UCGUUAGU UGGGUUAAAA UC|GU-U(GU AA)AGCAGAU UUGUUUAUAU 9241 AU|UUAAU-U UA|U|<---- ---------- ---------- ------auau auauuuaaa- 9301 >--------- ---------- -----uu-aa aca-(UAGU- AC(-GCA-)G GAUC-)auuu 9361 a--u~-<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.L.taren 10775 bp RNA RNA ~?~???? DEFINITION Kinetoplast Leishmania tarentolae.; 12S ribosomal RNA; 9S ribosomal RNA; ribosomal RNA. ACCESSION X02354 KEYWORDS 12S ribosomal RNA; 9S ribosomal RNA; ribosomal RNA. SOURCE Kinetoplast Leishmania tarentolae. ORGANISM Kinetoplast Leishmania tarentolae. REFERENCE 1 (bases 1 to 1665) AUTHORS de la Cruz,V.F., Simpson,A.M., Lake,J.A. and Simpson,L. TITLE kinetoplast (mitochondrial) ribosomal RNA from Leishmania tarentolae: conservation of peptidyl-transferase structural elements Primary sequence and partial secondary structure of the 12S JOURNAL Nucleic Acids Res. 13 (7), 2337-2356 (1985) STANDARD No information COMMENTS Organism information Culture collection: ? Sequence information (bases 1 to 10775) Corresponding GenBank entry: X02354 Phylo:Mitochondria,Kinetoplast,Leishmania BASE COUNT 491 a 71 c 105 g 506 t 9602 others ORIGIN 1 |~~~~~~~~~ uauuaaucaa auuuaauuaa uaaguaauau ugauuuuauu uaauuuuaag 61 uguuuaauua uauuuuugaa uuaaaauuuu auuauuuggu auuuaauauu uaaaaauauu 121 auauauuuua guuuuaaauu uguuguuuua uauuuaguuu aauauuuaua uauuaguaaa 181 uaauauagau uu-------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 |--------| ---------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ---------- |--------- 841 ---(----)- ---------- ---------- ---------- ---------- ---------- 901 ------(--- --)------- |--------- -------(-- ----)----- ---------- 961 -------<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- ---------- ---------- ---------( ------)--- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 ---------- ---------- --<------- ---------- ---------- ---------- 1861 ----->---- ---------- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--------- 2041 --)------- ---------- ------(--- -----)---- |--------- ---------- 2101 ---------- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->---- --(------) ---------- ---------- ---------- 2701 -----aauuu aa-aauuu-u ua-ugAACUG UUA-UUU-AU AGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----uuaau) ---------- 2821 --AUUU-U-U AG-UUUAAU( GUUUAAA-U) AUUUaACUA- --AUGAAGG- CACAGUU-Gu 2881 uc(u-auau) gua-ccua-u a-aaaaauag uaaaauuauu u--------- ---------- 2941 ---------- ---------- ------ ---------- 3061 --------|- ---------- ---------- ---------- ---------< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- -<-------- ---------- ---------a 3721 auuaauaaau aauuauuaac u-uaacuuaa aauuaauauu au>ggaaa-a uuu(aaaaa- 3781 -u-u)-aaau -uauu|u(u- uc)-|uaaua c(--aauuca )ua|-uaa-- ------<--- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 ->-------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|-- ---------| -------|-- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ---------- ---------- --------|- ---------- ---------- 4501 ---------- ---------- (-------)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- -|-------| ---------- ---------- 4681 --|------- ---------- ---------- (--------- ---------- ---------- 4741 ---------- -----)---- ------|--- ---------- ---------- -|-------- 4801 ---------- ---------- ----(----- --)---|--- ---------- ---------- 4861 ---------- ---------- ---------- -------(-- ---------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--------- ---------- ---------- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- ---------- 6481 ---------- ---------- ---------- ---------- ---------- ---------- 6541 -uuuuuuaaa aauauaaaaa -uauu-guu- ---------- ---------- ---------- 6601 ---------- ---------- ---------- ---------- ----<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- aauaaaauua uca>------ ---------- 6781 ------(--- )--------- -AGUUUUA|A AA---GCG-U UU(AUUAA)A UG-CGUC-GG 6841 UCUAAG|--- ---------- ---------- (-auuuaua- ------)--- ---------- 6901 ---------- UUUAAGAUU- aUUCUU- --------|- ---------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------- ---)------ ---------- ---------| 7141 ---------- --|----|-- -------(-- -----)---- --|U(AUU)- AG-UAGCAUA 7201 GUA-AU-U-U |AUUAAC(-U AAUU-)AUUA AA|GU-guuc ca-uAGAA-A A-UUUUAAAA 7261 UU-------- ---------- -------Au- -aacaaucua aaua-aa-ua au--aaauua 7321 aa|a|uaaag au-uu(u--a aaa-a)aaau uaA----AAA AUUAAAAUAG GGCAAG-UCC 7381 UAC-UC-|-U CCUUU--ACA AA|--G-AGA ACA--U---| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<-uuu--a u--------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- ---AU-G-UA -AUU-GU-AU GUUUGAUUG( 8161 GGG)CA-AUA C|UAUAUC(- --------UA GUUAUAUAG- )AAAA-AG|a |-|-----|< 8221 acuauaauca uugaa----- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ---------- ---------( ---------- )--------- ---------- ---------- 8821 ---------- ---------- ---------- ---(------ -)-------- ---------- 8881 -|-------- ---------- ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- ---------- --)--|---- 9001 --------a- |uAAUAAAAG GUUCGA|GCA G|GUUAACAA |G-CAU-U-A ---------- 9061 --(A--UAC- )--------- -----UAAAU GU-GUUUCAU CGUC|UA--C U|U|AUUGC| 9121 u--------- -----(-aau aaa)------ -------a|U UGAU(UGUUC )AUCAA-aaa 9181 u---GCAAU- --UCGUUAGU UGGGUUAAAA UC|GU-U(GU AA)AGCAGAU UUGUUUAUAU 9241 AU|UUAAU-U UA|U|<---- ---------- ---------- ------auau auauuuaaaa 9301 >--------- ---------- ----AUU-AA UAu-(UAGU- AC(-GCAA)G GAUC-)UAUU 9361 A--UU-~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.Lept.sp 10775 bp RNA RNA 11-JAN-191 DEFINITION Kinetoplast Leptomonas sp.. ACCESSION No information KEYWORDS No information. SOURCE Kinetoplast Leptomonas sp. ORGANISM Kinetoplast Leptomonas sp. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: J03814 LOCUS TRLKPRGXY 2568 bp ds-DNA ORG 15-SEP-1990 DEFINITION Leptomonas sp. 9S and 12S ribosomal RNA genes. ACCESSION J03814 KEYWORDS 12S ribosomal RNA; 9S ribosomal RNA; ribosomal RNA gene. SOURCE Leptomonas sp. kinetoplast DNA. ORGANISM Kinetoplast Leptomonas sp. Eukaryota; Animalia; Protozoa; Sarcomastigophora; Mastigophora; Kinetoplastida; Trypanosomatina; Trypanosomatidae. REFERENCE 1 (bases 1 to 2568) AUTHORS Lake,J.A., de la Cruz,V.F., Ferreira,P.C., Morel,C. and Simpson,L. TITLE Evolution of parasitism: Kinetoplastid protozoan history reconstructed from mitochondrial rRNA gene sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 85, 4779-4783 (1988) STANDARD simple staff_review COMMENT Draft entry and computer_readable sequence for [Proc. Natl. Acad. Sci. U.S.A. 85, 4779-4783 (1988)] kindly provided by L.Simpson, 06-MAY-1988. FEATURES Location/Qualifiers rRNA 351..1500 /note="12S rRNA (put.)" rRNA 1651..2250 /note="9S rRNA (put.)" BASE COUNT 968 a 207 c 322 g 1071 t ORIGIN BamHI site. BASE COUNT 465 a 75 c 117 g 505 t 9613 others ORIGIN 1 |~~~~~~~~a uuuuguuuuu auuuaucaau auaguuaaua aaauaaucua gaauuuuaug 61 uuaaauauau aauuauauuu uugauuauua uauuuuguua uuuuauuuaa guuaauuaaa 121 uuguauuaua uuuaauuuuu aaauuuguug uuuuauauuu aguuuuaugu uuauaauuua 181 augcaauacu gcaca----- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 |--------| ---------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ---------- |--------- 841 ---(----)- ---------- ---------- ---------- ---------- ---------- 901 ------(--- --)------- |--------- -------(-- ----)----- ---------- 961 -------<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- ---------- ---------- ---------( ------)--- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 ---------- ---------- --<------- ---------- ---------- ---------- 1861 ----->---- ---------- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--------- 2041 --)------- ---------- ------(--- -----)---- |--------- ---------- 2101 ---------- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->---- --(------) ---------- ---------- ---------- 2701 ----uauuuu aa-aauuu-u aa-ugAACUG UUA-UUU-AU AGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----ugauu) ---------- 2821 --AUUU-U-U AG-UUUAAU( GUUUAAA-U) AUUUaACUA- --AUGGAGG- CACAGUU-Gu 2881 uc(u-auau) gua-ccaa-u a-aaaaauag uaaaauuaau u--------- ---------- 2941 ---------- ---------- ------ ---------- 3061 --------|- ---------- ---------- ---------- ---------< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- -<-------- ---------- ---------a 3721 uuuaauaaau aauuauuuga ucaaaauuag uacaaauauu au>guaaa-a uuu(aaaaa- 3781 -u-u)-aaau -auuu|u(a- uc)u|aauau u(--aacuua )ua|-uua-- ------<--- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 ->-------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|-- ---------| -------|-- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ---------- ---------- --------|- ---------- ---------- 4501 ---------- ---------- (-------)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- -|-------| ---------- ---------- 4681 --|------- ---------- ---------- (--------- ---------- ---------- 4741 ---------- -----)---- ------|--- ---------- ---------- -|-------- 4801 ---------- ---------- ----(----- --)---|--- ---------- ---------- 4861 ---------- ---------- ---------- -------(-- ---------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--------- ---------- ---------- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- ---------- 6481 ---------- ---------- ---------- ---------- ---------- ---------- 6541 aauuuuuaaa auuauaauua -uauu-guu- ---------- ---------- ---------- 6601 ---------- ---------- ---------- ---------- ----<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- aauaaaauua uca>------ ---------- 6781 ------(--- )--------- -AGUUUCA|A AA---GCG-U UU(AUUAA)A UG-CGUC-UG 6841 UCUAAG|--- ---------- ---------- (-auuuaua- ------)--- ---------- 6901 ---------- UUUAAGAGU- aUUCUU- --------|- ---------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------- ---)------ ---------- ---------| 7141 ---------- --|----|-- -------(-- -----)---- --|U(AUA)- AG-UAGCAUA 7201 GUA-AU-U-U |GUUAAC(-U AAAU-)AUUA AA|GU-guuc ca-uAGAA-A A-UUUUAAAA 7261 UU-------- ---------- -------Au- -aacaaucau cgua-ac-ua au--aaauua 7321 aa|a|uaaaa au-uu(u--a aaa-a)aaau uaA----AAA AUUAAAAUAG GGCAAG-UCC 7381 UAC-UC-|-U CCUUU--ACA AA|--G-AGA ACA--U---| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<---uuaa u--------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- ---AU-G-UA -GUU-GU-AU GUUUGAUUG( 8161 GGG)CA-AUA C|UAUAUC(- --------UU GUUAUAUAG- )AAAA-AG|a |-|-----|< 8221 acuauaauua uugaa----- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ---------- ---------( ---------- )--------- ---------- ---------- 8821 ---------- ---------- ---------- ---(------ -)-------- ---------- 8881 -|-------- ---------- ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- ---------- --)--|---- 9001 --------a- |uAAUAAAAG GUUCGA|GCA G|GUUAACAA |G-CAU-U-A ---------- 9061 --(A--UAC- )--------- -----UAAAU GU-GUUUCAU CGUC|UA--C U|U|AUUGC| 9121 u--------- -----(auaa aaa)------ -------a|U UGAU(UGUUC )AUCAA-aaa 9181 u---GCAAU- --UCGUUAGU UGGGUUAAAA UC|GU-U(GU AA)AGCAGAU UUGUUUAUAU 9241 AU|UUAAU-A UU|U|<---- ---------- ---------- ------uuau uauuuuaaaa 9301 >--------- ---------- ----AUU-AA UAU-(UAGU- AC(-GCAA)G GAUU-)CAUU 9361 ---AU-<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.T.bruce 10775 bp RNA RNA ~?~???? DEFINITION Kinetoplast Trypanosoma brucei. ACCESSION No information KEYWORDS No information. SOURCE Kinetoplast Trypanosoma brucei. ORGANISM Kinetoplast Trypanosoma brucei. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Organism information Culture collection: ? Sequence information (bases 1 to 10775) Corresponding GenBank entry: X02547 Phylo:Mitochondria,Kinetoplast,Trypanosome BASE COUNT 464 a 66 c 129 g 493 t 9623 others ORIGIN 1 |~~~~~~~~~ auuuuaccaa uuaagaagaa uauuauaaua augggugucu uauauuuuaa 61 auaaauauuu aaauuccgug uaguaaauuu auuauuugua uuauuuauau aauaggugua 121 uuauauuuaa auuuuaaauu uguuguuuua uauuuagaua cauauuuaua gauuaauaua 181 uuuaaauaa- ---------- ---------- ---------- ---------- ---------- 241 ---------- ---------- ---------- ---------- ---------- ---------- 301 |--------| ---------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ---------- |--------- 841 ---(----)- ---------- ---------- ---------- ---------- ---------- 901 ------(--- --)------- |--------- -------(-- ----)----- ---------- 961 -------<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- ---------- ---------- ---------( ------)--- ---------- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 ---------- ---------- --<------- ---------- ---------- ---------- 1861 ----->---- ---------- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--------- 2041 --)------- ---------- ------(--- -----)---- |--------- ---------- 2101 ---------- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->---- --(------) ---------- ---------- ---------- 2701 -----uauuu ua-aaauu-u au-ugAACUG UAA-UUA-UU AGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----uuaau) ---------- 2821 --AUUU-U-U AG-UUUGAU( GUUGAAA-U) AUUUaAUUA- --AAGAUGU- UACAGUU-Gu 2881 uc(u-auau) gua-ccaa-a u-aaauauag uaagauuauu u--------- ---------- 2941 ---------- ---------- ------ ---------- 3061 --------|- ---------- ---------- ---------- ---------< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ---------- ---------- ---------- 3481 ---------- ---------- ---------- ---------- ---------- ---------- 3541 ---------- ---------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- -<-------- ---------- ---------a 3721 auuaauaaau aaauauuuau u-uuucu--u uguaaauauu au>gaaca-a uuu(aaaaa- 3781 -u-u)-aauc -uguu|u(a- ac)-|uaaaa u(--guuaua )ua|-uaa-- ------<--- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 ->-------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|-- ---------| -------|-- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ---------- ---------- --------|- ---------- ---------- 4501 ---------- ---------- (-------)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- -|-------| ---------- ---------- 4681 --|------- ---------- ---------- (--------- ---------- ---------- 4741 ---------- -----)---- ------|--- ---------- ---------- -|-------- 4801 ---------- ---------- ----(----- --)---|--- ---------- ---------- 4861 ---------- ---------- ---------- -------(-- ---------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--------- ---------- ---------- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- ---------- 6481 ---------- ---------- ---------- ---------- ---------- ---------- 6541 -uuuuuuaaa aauauaaaaa -uauu-guu- ---------- ---------- ---------- 6601 ---------- ---------- ---------- ---------- ----<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- aauaaaauua ucg>------ ---------- 6781 ------(--- )--------- -UAUUUUA|A GU---GCG-U UU(AUUAA)A UG-CGUU-UG 6841 UCUAAG|--- ---------- ---------- (-auaauua- ------)--- ---------- 6901 ---------- UUUAAGAUU- aUUCUU- --------|- ---------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------- ---)------ ---------- ---------| 7141 ---------- --|----|-- -------(-- -----)---- --|U(UAU)- UG-UAGCAUA 7201 GUA-AU-U-U |GUUAAC(-U AAAU-)AUUA AA|GU-guuc ca-uAGAA-A A-UUUUUAAA 7261 UU-------- ---------- -------Ac- -aacaaauaa aaua-aa-gu au--gaauua 7321 au|a|ucaaa au-uu(u--a aua-a)aaau uaA----AAA AUUAAAAUAG GGCAAG-UCC 7381 UAC-UC-|-U CCUUU--ACA AA|--G-AGA ACA--U---| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<-uau-ga u--------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- ---AU-G-UA -AUU-GU-AU GUUUGAUUG( 8161 GGG)CA-AUA C|UAUAUU(- --------UA UUUAUAUAG- )CAUA-AG|a |-|-----|< 8221 acuauauucu uugaa----- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ---------- ---------( ---------- )--------- ---------- ---------- 8821 ---------- ---------- ---------- ---(------ -)-------- ---------- 8881 -|-------- ---------- ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- ---------- --)--|---- 9001 --------a- |uUAUAAAAG GUUCGA|GCA G|GUUAACAA |G-CAU-U-A ---------- 9061 --(A--AAA- )--------- -----UAAAU GU-GUUUCAU CGUC|UA--C U|U|AUUAC| 9121 c--------- -----(--a- -ug)------ -------a|U UGAU(UGUUC )AUCAA-aau 9181 a---GUAAU- --UCGUUAGU UGGGUUAAAA UC|GU-U(GU AA)AGCAGAU UUGUUUAUAU 9241 AU|UUAAU-U UU|U|<---- ---------- ---------- ------aua- auuaauaaua 9301 >--------- ---------- ----AUU-AA UAu-(AAGU- AC(-GCAA)G GAUU-)GAUU 9361 A--UU-~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (2)-MYXOMY 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.P.polyc 10775 bp RNA RNA 18-AUG-1998 DEFINITION Mitochondrion Physarum polycephalum. subsp. RNA-Edited sequence; . ACCESSION AF080601 KEYWORDS . SOURCE Mitochondrion Physarum polycephalum. subsp. RNA-Edited sequence. ORGANISM Mitochondrion Physarum polycephalum. REFERENCE 1 (bases 1 to 2779) AUTHORS Yang,N., Costandy,H., Spottswood,M.R. and Miller,D.L. TITLE of Physarum polycephalum RNA editing of the mitochondrial large subunit ribosomal RNA JOURNAL Unpublished STANDARD No information REFERENCE 2 (bases 1 to 2779) AUTHORS Yang,N., Costandy,H., Spottswood,M.R. and Miller,D.L. TITLE Direct Submission JOURNAL Submitted (27-JUL-1998) Cell and Molecular Biology, University of Texas at Dallas, 2601 North Floyd Road, Richardson, TX 75080, USA STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: AF080601 BASE COUNT 941 a 420 c 515 g 903 t 7996 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~uacu-u uuaagaaucu aua------- ---------- ---------- 241 ---------- ---------- ---------- -----auaaA AAUUCUUGA- ----CGGAUA 301 |UAU--AGA| UUU-UUUA-U G|uaggcu-- ---------a uucaauaca| -aucu(-uau 361 agg------) a|gauauua- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---- -----aUAAC |AUAAUGAAU 841 UGA(AACA)U CUCAGUA--- -AUUAU---- ---------- ---------- ----GGAUUA 901 UAAACA(-AA CC)UG-A-AU |UUU-AUUA- -GUAG-U(-G GUGA)GCGAA -CAUAAAAU- 961 -auuuua------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- GUg|U(GUC) 1321 A--GAAG(UU AAAAC)CUUg ua-------- ---------- ---------- ----------- ------(--- ---------- 1561 -------)-- ---------- ------ugga g(uacca-c) -cuuca---a uauua-aaca 1621 ---CA-UAAA A-AAAUCGAU AGCG-AA--- -AAAGUACC( -GUGA-)GGG ---AAC-UA- 1681 UG-------- ---------- ---------- ---------- ---------- ---------- 1741 aaaagcacuc g(aucua-a) agag------ ---------- ------guUG AA--AUAGA- 1801 UCUUG-AAAU CAAG-AAU-U U-<------- ---------- ---------- ---------- 1861 ----->AAAA GCAuuugaug uuuuu---<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (----caagg 2041 --)---aaaa auaccaaa-G UACCUU(UU- GUAUC)AUGG |AUC-AACGA GA-----UA- 2101 AAUGAAAAAG CAA--gcuua u-au---(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ------auua u)-----aua gcauag-cga 2521 aag-(-caaa )--uuu---- --(------) ---------- -----UUGAG UUUUU-UCAU 2701 UUA-AACCCG AA-ACCUA-G UG-AUCUAAU CAU-GAG-CA GAUUGAA--- A-UG--AG-U 2761 -(-------- ---------- ---------- ---------- -----uaac) AACUUUUGGA 2821 GGAUCGAA-C CCUU-UUCU( GUUGCAU-C) AGAA-UGGGA --UGACUUG- UGAUUAG-GG 2881 GU(G-AAAG) GCU-AAUC-A A-ACUAGGAG AUAGCU-GGU UUUCU--GCG AA-AUG-UAU 2941 (-UUAG)GUA CC-GU-GAUA GUUU-u uuc|-cuggu 3061 c|guaaag|c aagaagc-gg ga-uau--aa aagcuu--(u uaauc---)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->--aag cua-cu---c 3301 auu--c---- aaacu-c--- uaaa|-gaca -g-g---gaa a--------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -uuu--AU-C -UAUU-AUAC AGACU--UU- GG-GU(-GCU 3481 AAG)GUCCUU GG-UC----U AAAGGA(GAA -GAG)UCC-U CACAC-U-CA -GC-UAA--- 3541 --GGA-CCGC -AAU-AA-A- ACUUAAGUC- ---------- ---aaagau- aucuuauuac 3601 -aa------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AGACA-AAAC G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAUGU-A GGC(UUUCAA 3781 GC-A)-GCCA -UCUU|U(U- AA)A|GAAAG C(--GUUACA )GC|-UCAC- GUUUCA<--- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 --agu-a--c -aa-gau|au uaca------ ---------- ---------- ----aauaaa 3961 ggauu----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---uuucguu uua------- ---------- ---------- ---------- 4081 -------|UC CAAA--GCU| A--G-UG|aa ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 uuuauu)--- ---------u -u-----GAU AGCAG-AA|- UC-CUUAGUU U---UUAAUG 4501 G--------- -AUAA-UUUA (GUAA---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->UA UUU--UAU-U U|-UAA---| AUCUAAGUGA AAAAUGU-UG 4681 AU|AUCAGUA -GUUU-UUA- uaa-cg---- (auua----- ---------- ---------- 4741 ---------- -----)---- uguuau|cgc c-aaag-uuu aaa--GGUUU -|----CCUU 4801 AUCCA---UU ---------- ----(--CUU UA)A-A|-GA UAAGGG---- ---------- 4861 ---UUAUA-- -CGUCCUCUC A-U-G-U--- UUUAGC-(-G AAA------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--gca---a ca---a-caa ag-gaguuu- gaug(----- ---------- ---------- 5041 ---------- -auuaaaaau ----)cauuu |---gu|uuu a--auauugu -ga------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---------- ---------- ---------- ---------- 5521 ---------- ---------- ---------- ---------- ---------- ---------- 5581 ---------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ---------- ---------- ---------- ------ ---------- guuaaa-aua aaacgua|cu 6481 ---aAAACC- -(GACACU)G G|uaaac-ua gua-(-aa-u ------)-ua cugcggcg-| 6541 |--AUGGA-U U--AACUAUA -CUAA-AGGA ACUCGGCAAA UUCAAU-CUG UAAC(UUUU- 6601 )GGAGAA-AG AUU|aucaua auuuucc--- ---------- ---------- -------UGU 6781 -GAU|G(GCA )C--AGAAUA GAGGGUAG|C GA---CUG-U UU(AUUAA)A AA-CACA-GG 6841 ACUCUG|CU- -AAGUA---- ---------- (--UAAA--- ------)--- ---------- 6901 UAUGAUGUA- UAG--GUCUG AGACCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-GU|G UCAGUA-ggu aaacga-ga- 7021 --cugauu-a u-(------- ---------- ---------- ---------- ---------- 7081 --------cu uuaagucucu uucagauaau uua)auu-ug uuag--ucuc u-uaaauca| 7141 CU-GGUA-AA C-|GG-C|-G -GCUGU-(AA CUAUG)ACGG UC|C(UAA)- GG-UAGCGAA 7201 AUU-CC-U-U |GUCGGG(-U AAGU-)UCCG AC|GU-GCAC GAAUGGUGUA A-CGACUUCC 7261 CU-------- ---------- -------ACU GUCUCUAGUG UAGA-UC-CA ----AUGAAA 7321 UU|G|GAAUU AU-UG(U-GA AGAUA)CGAU AUA----GAA AUAGCCAGAC GGAAAG-ACC 7381 CUGUGA-|-A CCUUU--ACU AU|--a-ugc uuu--uauu| ------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- ---------uuu aauga-a-ag -ugg--U-UA GUUUGACUG( 8161 GGG)CG-GU- A|GCCUCC(- --------CA AAUCGUAAC- )GGA----|G |U|GCG--|< 8221 uacaaaagau uuguuacguu uagauuuauc uacac----- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ---------- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- ---gaua|GC (G|CAAGG)G Cua-aua-cu 8761 u-gu-CUGAC UGUUU-GAA( -ugacaa--- )UUCAU-UCA G--------- ---------- 8821 ---------- ---ggauuUA UU-------- ---(UUUA-- -)-------- ----AAUCGG 8881 U|---CCUAG UAAUC-CAAU CU-U------ ---------- AAC(------ ---------- 8941 ---------- ---------- ---------- ---------- ----CUGUGG GC)GU|AGGA 9001 UUGC-CAAC- |GAAUAAAAG GUACUC|CGG G|GAUAACAG |G-CUG-A-U AAUUCCUUAG 9061 AG(U--ACCU )AUCGACGGA --AUUGUUUG GC-ACCUCGA UGUC|GG--C U|C|AUCAC| 9121 AU-CC-UGAG AC-UG(--AA -AA)GGGCCU CAAG-GGU|U CGGU(UGUUC )ACCGA-UUA 9181 AU-AGUGGU- --ACGUGAGC UGGGUUUAGA AC|GU-C(GU GA)GACAGUU CGGUCCCUAU 9241 CU|acuau-u uc|a|<---- ---------- ---------- ---------- ---------- 9301 >----u-aag acguaa-aag uug-UUC-UG UC--(UAGU- AC(-GAAA)G GACU-)GGUG 9361 G--AA-<--- ---------- ---------- -------->C GAUUCCU-CU GGUUUUUGAG 9421 C|-ugu---- (uugc-)<-- ---------- ---------- ---------- ---------- 9481 ---------- ---------- ---------- ---------- ---------- ---------> 9541 ----GCAC-G CUCA--UUCG CUAC-GAAUC UU-------- ---------- -------UUA 9601 ---------- -UUAAUCGCU (GAAAGC--A U-CUA)A-GC -GA-GAAAUA Au-acuu--- 9661 -uaag--u-- -cuuuu-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ------(--- )--------- ---uaac|CG 9961 UUG(UAGACU A--)UAACGU C--------- ---------- ---------- ------aaua 10021 g|gcucauga ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---aaugcau guc------- ---------- --------(- ---------- 10141 guaagauuug auuauagagu a)gaugcuug caaaagcuuu ---------- ---------- 10201 ---acucacc a|a|ucauca cuaac----- ---------- ---------- ---------- 10261 ---------- ---cauua-- ---------- ---------- ---caa---- ---auuuuac 10321 cuu-----|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (2)-CROWN 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (3)-ACANTH 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.A.caste 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Acanthamoeba castellanii. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Acanthamoeba castellanii. ORGANISM Mitochondria Acanthamoeba castellanii. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: U03732 LOCUS ACU03732 7778 bp DNA INV 01-JUN-1994 DEFINITION Acanthamoeba castellanii Neff mitochondrion rRNA large subunit gene. ACCESSION U03732 KEYWORDS . SOURCE amoeba ORGANISM Mitochondrion Acanthamoeba castellanii Eucaryotae; Protozoa; Sarcomastigophora; Sarcodina; Rhizopoda; Lobosa; Amoebida; Acanthamoeba. REFERENCE 1 (bases 1 to 7778) AUTHORS Lonergan,K.M. and Gray,M.W. TITLE The ribosomal RNA gene region in Acanthamoeba castellanii mitochondrial DNA JOURNAL Unpublished STANDARD full automatic REFERENCE 2 (bases 44 to 462) AUTHORS Lonergan,K.M. and Gray,M.W. TITLE Predicted editing of additional transfer RNAs in Acanthamoeba castellanii mitochondria JOURNAL Nucleic Acids Res. 21, 4402-4402 (1993) STANDARD full automatic REFERENCE 3 (bases 5550 to 6183) AUTHORS Lonergan,K.M. and Gray,M.W. TITLE Editing of transfer RNAs in Acanthamoeba castellanii mitochondria JOURNAL Science 259, 812-816 (1993) STANDARD full automatic REFERENCE 4 (bases 1 to 7778) AUTHORS Lonergan,K.M. TITLE Direct Submission JOURNAL Submitted (24-NOV-1993) Kim M Lonergan, Biochemistry, Dalhousie University, Sir Charles Tupper Medical Building, Halifax, Nova Scotia, B3H 4H7, Canada STANDARD full automatic COMMENT NCBI gi: 495327 FEATURES Location/Qualifiers tRNA 44..462 /citation=[2] /note="tRNA gene cluster 1; GenBank Accession Number L20506" rRNA join(463..2232,2988..3007,3868..4500,5254..5549) /product="ribosomal RNA large subunit" /citation=[1] exon 463..2232 /number=1 intron 2233..2987 /number=1 exon 2988..3007 /number=2 intron 3008..3867 /number=2 exon 3868..4500 /number=3 intron 4501..5253 /number=3 exon 5254..5549 /number=4 tRNA 5583..6118 /citation=[3] /note="tRNA gene cluster 2" misc_feature 5550..6183 /note="GenBank Accession Number M97651" rRNA 6184..7724 /product="ribosomal RNA small subunit" /citation=[1] source 1..7778 /clone_lib="ATCC 30010" /strain="Neff" /organism="Acanthamoeba castellanii" /mitochondrion CDS 2438..2866 /note="rRNA large subunit intron 1 orf; NCBI gi: 495328." /codon_start=1 /translation="MKIDKNWIVGFVDGEGCFYIGINKSVDSKLGYQVLPEFRVVQHK RDIKVLYAIKDFFGHGSVVCNKSNGSEIYEYRVRKFETLHDVILPFFESNGLLTSKKF NFLAFRDVILIMKRREHLTESGLSKIIDIKSRMNRSSIHY" CDS 3275..3781 /note="rRNA large subunit intron 2 orf; NCBI gi: 495329." /codon_start=1 /translation="MKNLDLKQEKALIDPFWISGFVDGEGCFCISFNLKERLTLGIEV RPSFSISQTRDKEGLNLRCLQDFLNFFDCGFIRFSKRDNTWKYECRDLSDIRSKVLPH FEKFTLRTKKLRDFELFKDVVNSVASKQHLNEVGLKRIIDISYQINMGKRKLTKDELL SKINLKNL" CDS 4633..5127 /note="rRNA large subunit intron 3 orf; NCBI gi: 495330." /codon_start=1 /translation="MQKNQFKKLNNEQLAYLAGFVEADGCFLVQIIPGLQYRYKHTIR ISIVFYQKKDKHWYFLQLKNLIGLGSIRFRNDGMLEYSITGLSLVNKFLEMLFPYLIL KKNLAVLIFRIIKGLNDVKNEAGFLEVCKLVDEVADHTYSKKRKNTSLTVKNSLLLPV ETEE" BASE COUNT 2621 a 1062 c 1582 g 2513 t ORIGIN BASE COUNT 948 a 355 c 566 g 850 t 8056 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~uu 181 gauuauaaau acaaauaa-g uaauuauaua aaaau----- ---------- ---------- 241 ---------- ---------- ---------- -----UAAAG GGUAAAUAA- ----CGAAUA 301 |UCUuaUAG| CAU-AAAA-G U|uu------ ---------- -----cugg| -cgcc(-uaa 361 ucg------) a|gcg-aaa- uauacaa|ug --agu--(-- ---------- --------cg 421 aaaaauu)-- acuuaga--a uuguaaa-uu ccag--c-AG A--------- -----(GAAA 481 )UCU|----- ---------- ---------- -aaca----- ---------u uuaaau-au- 541 ---------- -----uguu- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- -----cUUAC |CUAAUUAAG 841 UGA(AACA)U CUCAAUA--- -GUUAG---- ---------- ---------- ---AGGAAAG 901 GAAAAU(-AA UU)AAAG-AU |UUU-GUUA- -GUAA-U(-G GUGA)GUGAA -AACAAAAU- 961 -AGCCAA<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------a auuugaauuu aaggaaauag aagucuuau< ---------- ---------- 1261 ---------- ---------- ---------> (augau-)uu aagc------ GC-|C(AUA) 1321 G--AAGG(UG AAAGC)CCUu ua--uaauuu cuuauuuuua auauauauaa u-auGAGUAAA AUAAAA(--- --------uc 1561 ugugaaa)UU UUAUUGGAAA ----aaGGCA A(ACCCA-U) -UUGCUA--A GGCUaaauac 1621 ---AC-UUUU A-UGACUAAU AGUG-AA--- -CAAGUACU( -GUGA-)AGG ---AAA-GA- 1681 UG-------- ---------- ---------- ---------- ---------- ---------- 1741 AAAAG--ac- -(--aaa--) --gu------ ---------- ---------- --uaAAAGA- 1801 UCUUG-AAAU UGUU-UAC-C U-<------- ---------- ---------- ---------- 1861 ----->-uaa ggaucuagag cgca----<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (----gcgaa 2041 --)----ugu guuauagg-G UGCCUU(UU- GCAUA)AUGA |GCG-GGCGA UU-----UCU 2101 AAGGAACUAG CAA--acuau g-guc--(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- -------guu a)----gaug --aagg-uGA 2521 AGU-(-GAAA )--GCG<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ----->-agc uu(uaauu-) aa-gcg---- -----uuAAG UUAGU-UUUU 2701 UGA-GACUCG AU-ACUAA-G CG-AUCUAUU UAC-UGC-CA GAUUGAA--- A-GU--AC-U 2761 U(-------- ---------- ---------- ---------- -----uaac) ACGUACUGAA 2821 GGAUCGAA-C CC-AUGUAU( GUUGCAU-A) AUAC-CGGGA --UGAGUGG- UAGCUAG-GG 2881 GU(G-AAAG) GCU-AAUC-A A-GCUUAGUG UUAGCU-AGU ACUCU--ACG AA-AUC-UAU 2941 (-UUAG)GUA GA-GC-GUUC UGUU------ ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- --------ca cau|-UAUUG 3061 U|UGGUAG|A GCUCUAG-gu aa-gca--au gggaa---(u uaauac--)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->---uu cua-cu-gag 3301 uuu--ac-UU AAACUGCG-- AAUA|-GCAA -U-A--aauu ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -uuuuuAC-A -GAGC-AGGC AGAUU--GC- GG-GC(-GCG 3481 AAG)GUUCGU AA-UC----G AAAGGG(AAA -CAG)CCC-A GAAUA-U-CA -GC-UAA--- 3541 --AGU-CCAU -AAA-AA-U- AAUUAAGUG- ---------- uaugaAAUA- AUCUAAAGUG 3601 uua------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- uaaca-AUUA G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAGGU-U GGC(UUAGAA 3781 GC-A)-GCCA -UCCU|U(U- AA)A|GAAAG C(--GUAACA )GC|-UCAC- UAAUuuGCA-UU-A -UA-GGG|-U UUuaugau-- ---------- ---------- -----auaac 3961 ggacu----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---aaAAUUA UUU------- ---------- ---------- ---------- 4081 -------|AC UGAA--GCU| A--U-AU|G- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 aaau--)--- ---------- -C-----GGU AGUAG-AG|- UA-UCUUAUA U---uuuau- 4501 ---------A GAUAA-AUUU (GUGA---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->GA AUU--UAU-U A|-auau--| AUUAAGAGAA AGUAUGC-CU 4681 GU|AUGAGUA -GCA---AA- GAA-UA-GU- (gagaa---- ---------- ---------- 4741 ---------- -----)-A-C UAUUC-|CAC C-GUAU-AUA UAA--GGUUU -|----CCUA 4801 UUuaua--AA ---------- ----(--UUU AU)U-U|-UA AUAGGG---- ---------- 4861 ---UUAAU-- -CGGCCCCUA A-G-U-Uu-- uauAAU-(-G ACA------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--auu---a ua---G-GCG AU-GGGUUU- UGGG(----- ---------- ---------- 5041 ---------- --uuaaaauu ----)CUCAA |---AU|uuu u--caguaag |ug<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-a caaaggg-gg cagguuauuu aau------u 5461 uuaau(aaaa uua---)auu aag|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- ---------- ---------- --uaaucagg 5581 a-<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->cc uuuccggaaa ----aa-gcu uug<------ 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ------aaaa uaaaaa---- -ACCGUA|CU 6481 ---UAAAUC- -(GGCUCC)G A|UAUUU-UG AUA-(GAG-U A-----)-UA UUAAGGUG-| 6541 |--AUAGG-A U--AAUAAUA -UUGA-AGGA ACUCGGCAAA AUAGCU-CCG UAAC(UUCG- 6601 )GGAGAA-GG AGU|accuuu uguaa----- -----(gcaa ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- ---------- -uuacuuaua 6781 -ggu|G(UAA )C--AGAAUA GAGGGUAG|C GA---CUG-U UU(ACUAA)A AA-CACA-GG 6841 ACUCCG|CU- -AAGUU---- ---------- (--GUAA--- ------)--- ---------- 6901 AACGAUGUA- UAG-GGUCUG ACACCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-GU|G CUGAAA-GAU aaaaag-gau 7021 --UGGUA--- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------g gaa)-----U GCCA-ugaau a-UAAAUC-| 7141 UC-AGUA-AA C-|GG-C|-G -GCUGU-(AA CCAUA)ACGG UC|C(UAA)- GG-UAGCGAA 7201 AUU-CC-U-U |GUCGGG(-U GAGU-)UCCG AC|CU-GCAU GAAUGGUGUA A-CGACUUCC 7261 CU-------- ---------- -------ACU GUCUCCAGUA UUAA-CC-UA ----GUGAAA 7321 UU|A|AACUU GC-UG(U-GA AGAUG)CAGU AUA----UAA AUGAUUGGAC GGAAAG-ACC 7381 CUGUAC-|-A CCUUU--ACU AU|--A-AUC AUA--GAUU| <--------- ---------- 7441 ---------- ---------- --->GUUUU- UA-----AAA -uauugaaua UGU---AGGA 7501 UAAACAGcaa -GCUu---au u-auacuuua au<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----gcu a)guuaau-u guu--uaGGC 7681 AAUAGUGAAA UACUGUU|-- -----uuuu- uaa-U-UUUU AAAA-Cuaa- -cuaa----- 7741 -----(---a uu--)----- ---------- ---------- ---------- ----uuag<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->-GAU AGUUU-A-UG -ACU-GG-UA GUUUGACUG( 8161 GGG)UG-GU- C|GCCUUC(- --------UA AAUAGUAAC- )GAAG-GC|G |U|GCAA-|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->augg-uaa 8401 -ua|--au-- aauuaa<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (uuaaaaa-- )----uuaau uu-------- ---------- 8701 ---------- ---------- ---------- ---gaaa|AU (U|UAAUG)G Uaa-aag-au 8761 u-gc-UUGAC UGAGUAGAu( -cgacag--- )aUCGAGUCA G--------- ---------- 8821 ---------- --------AG AC-------- ---(GAAA-- -)-------- ----GUC-GG 8881 C|---CAUAG UGAUC-CAAU AG-U------ ---------- GCU(------ ---------- 8941 ---------- ---------- ---------- ---------- ----GAAUGG AA)GG|GCUA 9001 UUGCUUAAC- |GGAUAAAAG GUACGU|CAG G|GAUAACAG |G-CUA-A-U GGGCCCUAAG 9061 AG(U--CCUU )AUCGACGGG --CUUGUUUG GU-ACCUCGA UGUC|GA--C U|C|AUCAC| 9121 AU-CC-UGGA GC-UG(--CA -GG)CGGUUC CAAG-GGU|U AGGC(UGUUC )GCCUA-UUA 9181 A--AGUGGU- --ACGUGAGU UGGGUUUAGA AC|GU+C(GU GA)GACAGUU CGGUUCCUAU 9241 CU|GUCAU-U UU|G|<---- ---------- ---------- ---------- ---------- 9301 >--uaa-aaa c--uaa-AAA AAU-GUU-UC UU--(UUGU- AC(-GAGA)G GAUU-)GAGA 9361 A--AU-<--- ---------- ---------- -------->G UAUACCA-CU GGUAAAUCGA 9421 U|-UGU-ACU (guca-)<-- ---------- ---------- ---------- ---------- 9481 ---------- ---------- ---------- ---------- ---------- ---------> 9541 aag-gcaUUG UCGA--GUAG CUAC-GUAUA Aau------- ---------- -------uuu 9601 ---------- -AUAAUUGCU (GAUAGC--G U-AUA)A-GC -AA-GAAAAU GAuuuuu--- 9661 ---au--g-- -uuuuu-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- ---------- -uuaaac|GG 9961 UUG(UAGAUA A--)UAACUU U--------- ---------- ---------- -----uUAUA 10021 G|GCGCGAAA ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---uua-aAU UUG------- ---------- --------(- ---------- 10141 ---------- -------GUA A)CGAAU--- ---------- ---------- ---------- 10201 ------ggUU U|A|CGCGUA CUAau----- ---------- ---------- -----uauua 10261 a--------- ---------- ---------- ------auuu uuuauauaug auuu|uuuug 10321 caauuu--|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (3)-ALVEOL 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.P.aurel 10775 bp RNA RNA 25-JUL-1994 DEFINITION Mitochondria Paramecium aurelia.; 5.8S ribosomal RNA; apocytochrome; apocytochrome b; atp 9 gene; ATP synthetase; cytb gene; cytochrome c oxidase; cytochrome c oxidase subunit I; cytochrome c oxidase subunit II; dehydrogenase; dicyclohexylcarbodiimide-binding protein; NADH dehydrogenase; ND1 protein; ND2 protein; ND3 protein; ND4 protein; ND5 protein; ndh1 gene; ndh2 gene; ndh3 gene; ndh4 gene; ndh5gene; oxidase; P1 gene; P1 protein; psbG gene; ribosomal protein; ribosomal protein L14; ribosomal protein L2; ribosomal protein S12; ribosomal protein S14; ribosomal RNA; ribosomal RNA large subunit; ribosomal RNA small subunit; synthetase; transfer RNA; transfer RNA-Phe; transfer RNA-Trp; transfer RNA-Tyr. ACCESSION X15917 KEYWORDS 5.8S ribosomal RNA; apocytochrome; apocytochrome b; atp 9 gene; ATP synthetase; cytb gene; cytochrome c oxidase; cytochrome c oxidase subunit I; cytochrome c oxidase subunit II; dehydrogenase; dicyclohexylcarbodiimide-binding protein; NADH dehydrogenase; ND1 protein; ND2 protein; ND3 protein; ND4 protein; ND5 protein; ndh1 gene; ndh2 gene; ndh3 gene; ndh4 gene; ndh5gene; oxidase; P1 gene; P1 protein; psbG gene; ribosomal protein; ribosomal protein L14; ribosomal protein L2; ribosomal protein S12; ribosomal protein S14; ribosomal RNA; ribosomal RNA large subunit; ribosomal RNA small subunit; synthetase; transfer RNA; transfer RNA-Phe; transfer RNA-Trp; transfer RNA-Tyr. SOURCE Mitochondria Paramecium aurelia. ORGANISM Mitochondria Paramecium aurelia. REFERENCE 1 (bases 1 to 40469) AUTHORS Pritchard,A. TITLE Direct Submission JOURNAL Submitted (21-JUL-1989) to the EMBL/GenBank/DDBJ databases. Pritchard A., University of Colorado Health Science Centre, Department of Microbiology, Denver CO 80262, U S A STANDARD No information REFERENCE 2 (bases 1 to 40469) AUTHORS Pritchard,A.E., Seilhamer,J.J., Mahalingam,R., Sable,C.L., Venuti,S.E. and Cummings,D.J. TITLE Nucleotide sequence of the mitochondrial genome of Paramecium JOURNAL Nucleic Acids Res. 18 (1), 173-180 (1990) STANDARD No information REFERENCE 3 (bases 1 to 40469) AUTHORS Valverde,J.R., Marco,R. and Garesse,R. TITLE A conserved heptamer motif for ribosomal RNA transcription termination in animal mitochondria JOURNAL Proc. Natl. Acad. Sci. U.S.A. 91 (12), 5368-5371 (1994) STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: X15917 For overlapping sequences see accession numbers <K00904>, <M15275>, <M15220>, <K01751>, <K01749>, <X04157> and <M26930>. NCBI gi: 13256 BASE COUNT 870 a 395 c 563 g 830 t 8117 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~----- -----uuugc agucu----- ---------- ---------- 241 ---------- ---------- ---------- -----aacaA AGCACUAGA- ----CGGAUG 301 |CCU--AAA| AAUCUUGG-U U|gagggcgu aa-------- -----aucu| -aaau(--ac 361 gau------) a|uuuguau- gUAAGC-|UU --ucuuu(-- ---------- ---------- 421 ugauau-)au agaa-----U UGCUUA---- ggaugua-ca agggc----- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ccuugaAAAU |UUUAUGAAG 841 CGA(AACA)U CGUAGUA--- -AUAAA---- ---------- -----uc--- ---uaaaaca 901 uAAUUC(-AA CU)GA-G-AU |GUU-AA-A- -GUAA-C(-G GUGA)GUGAA --acaaagu- 961 -AGCUCA<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- -aaaauuaga aaagagggcu gaauuacuu< ---------- ---------- 1261 ---------- ---------- ---------> (ggaa--)aa guaa------ GC-|U(ACA) 1321 G--UGGG(UG AUAGC)CCCg ua--agcuuu u--GAGUAUA UAUUAU(--- ---------- 1561 uaacaaa)AU AAUAUAGAAA ------uguu u(-uuca-a) -aaaaaa--A AGCUA--AUA 1621 ---AAACCAA A-UU-UUGAU AGAA-AA--- -UAAGUACC( -GUGA-)GGG ---AAA-GG- 1681 UG-------- ---------- ---------- ---------- ---------- ---------- 1741 AAAAGAAAUU U(-gua---) GAAU------ ---------- ---------g uuuaAAAGA- 1801 UUCUG-AAAU CUAG-UGC-A G-<------- ---------- ---------- ---------- 1861 ----->UGAA ACAGUUAAAG C-------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (----guguu 2041 --)------- GUUUUAAC-G UACCUU(UU- GUAUA)AUGG |GCC-AACUA GU-----UU- 2101 AUAAAAUUAG CGA--gc--- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- -uuaucaaau c)-------- -----g-cGU 2521 AAU-(-GAAA )--AU----- --(------) ---------- ---------G UUAAU-UUUA 2701 UAA-GACCCG AA-GUCAA-G UG-AUCUAAU CAU-GGC-UA GGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----agaag) ---------- 2821 --AUCGAA-C CC-AUAAAU( GUUGCAA-A) AUUU-CGGGA --GAAGCUG- UGAUUAG-GG 2881 GU(G-AAAG) GCU-AAUC-A A-ACUUGACG AUAGCU-GGU UUUUC--GCG AA-AUC-UAU 2941 (-CUAC)GUA GA-GU-AUUU uuuU------ ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- --------uc UUU|-UGUGC 3061 G|GGGUAG|U GUAAUCU--u uu-cuu--aa gaaga---(u cuga----)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->---uc uu--uu-uuc 3301 gug--a--AG AAUCUUCC-- AAUA|-CGCA -U-U---AAA ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -au---aa-u -AAAUAAAAC GGACU--GA- GA-GU(-GCA 3481 AAG)AUUCUU GG-UC----G AGAGGG(AAA -CAG)CCC-A GACCG-U-AC -GA-UAA--- 3541 --AGU-GCAU -AAA-CA-A- UGCGAAGUA- ---------- -----aaag- aauuguuuuu 3601 aaa------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- aaaau-AUCG G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAGGU-A GGC(UUAGAA 3781 UC-A)-GCCA -GCCU|U(U- AA)A|GAAAG C(--GUAACA )GC|-UCAC- CAAUAGuaa-aa-a -ua-auu|-u uuaa------ ---------- ---------- ----auuaaa 3961 GCGCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ----AAGCAU UGU------- ---------- ---------- ---------- 4081 -------|AC UGAA--GCG| G--C-GG|G- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 aacu--)--- ---------- -C-----GGU AGCGA-AA|- CG-UUUUGUA G---GUUGUU 4501 G--------A AGGUU-UAUU (GAGA---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->AA UAG--GCU-G G|AGAU---| AUCAAAAUUG AUAAUGU-UG 4681 GC|AUGAGUA -AUA--GAC- AAA-AU-GU- (ucaaa---- ---------- ---------- 4741 ---------- -----)-U-C AUUUU-|UGU U-UGAU-AAG UUA--GGGUU -|----GCUU 4801 UGUUUu--GA ---------- ----(--UCA UC)U-U|-AC AAAGUG---- ---------- 4861 ---UGAUC-- -CGGUCUCUA A-U-U-U--- uuuAAAU(-a gau------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-auuu---- uu---A-AAG AU-GAGCU-- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ------|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---|------ ---------- ---------- ---------- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- -ACCGUA|CU 6481 ---AACACU- -(AACGCA)A G|UACUU-UA GUC-(GAG-C A-----)-GA UGACGACAA| 6541 |--AAGAG-C U--AAUGAUA -UUGA-AGGA ACUCGGCAAA AUUACU-UUG UAAC(UUCG- 6601 )GGAUAA-AA AGU|gc---- ---------- -----(guca ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- ---------- ---------- 6781 --gc|a(aac )aaaaaaaug GGGGGUAG|C GA---CUG-U UU(ACUAA)A AA-CAUA-AG 6841 AUUUUG|CA- -AAAUU---- ---------- (--uaau--- ------)--- ---------- 6901 UAUGAUGUA- UAA-AAUCUG ACUCCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-GU|G UUGUCA-UGC AAAGUU-UU- 7021 --AACGGu-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------u agc)----gC UGUU--GAUA A-CAAGCA-| 7141 GC-AAUA-AA C-|GG-C|-G -GCCAU-(AA CUCUG)AUGG UC|C(UAA)- GG-UAGCAAA 7201 AUC-CC-U-U |GACGGG(-U AAGU-)UCCG UC|CU-GCAC GAAUGGAGUA A-CGACUGCC 7261 CU-------- ---------- -------ACU GUCUCCAAUA UCAG-CU-CU ----AUGAAA 7321 UU|G|AAUUU GC-UG(U-GA AGAUG)CAGC UU-----UUU ACAACUAGAC GGAAAG-ACC 7381 CUAUGC-|-A CCUUU--ACU GA|--U-GCU AGG--AACU| <--------- ---------- 7441 ---------- ---------- --->AAAGG- GA-----UAU -Acuggaga- ua----aauU 7501 AAGGUAGGA- -gu------- ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----uaa a)-------- --------uc 7681 gcAAUUGAAA AACUACU|u- ----cucuu- u-U-A-CGUC UCUU-Cau-- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------uuua cuUUU-C-UG -GCU-GU-UA GUUUAACUG( 8161 GGG)CG-GU- U|GCCUCC(- --------UA AAAAGUAAC- )GGAG-GU|G |A|GCAU-|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->A-AAgUUA 8401 -CG|--CU-- uuguga (auuuu---- )ucuuugcaa aa-------- ---------- 8701 ---------- ---------- ---------- ---ugAG|uu (-|-AAUA)a aac-uGC-GU 8761 A-AU-UUGAU UAAAU-UAC( -aaacua--- )GUAAU-UUA G--------- ---------- 8821 ---------- --------GG GC-------- ---(uaauu- -)-------- ----GCC-UG 8881 C|---UAUAA UGAUC-CGGU GU-U------ ---------- UUU(------ ---------- 8941 ---------- ---------- ---------- ---------- ----UUUUGA AU)AA|GACA 9001 UCGCUCAAC- |GAAUAAAAG GUACGC|UAG G|GAUAACAG |G-CUU-A-U AAAUUCUGAG 9061 AG(U--UCCU )AUUAAAGAA --UUUGUUUG GC-ACCUCGA UGUC|GG--C U|C|AUCAC| 9121 AU-CU-UGGU GG-UG(--CA -GA)AUCUGC CAAG-GGU|U UGGC(UGUUC )GCCAA-UUA 9181 A--AGUGGU- --ACGUGAGC UGGGUUUAAA AC|GU-U(GU GA)GACAGUU UGGUCCCUAU 9241 CU|GUUGU-A GA|A|<---- ---------- ---------- ---------- ---------- 9301 >UUAAG-AAA CG-AGG-CUG AGA-UCG-AC GC--(CAGU- AC(-GAGA)G GACC-)GACU 9361 A--GA-<--- ---------- ---------- -------->A CUAGCCU-CU GGUUCGGGAU 9421 C|-UAC-UUU (aaaua)<-- ---------- ---------- ---------- ---------- 9481 ---------- ---------- ---------- ---------- ---------- ---------> 9541 AAG-GUAUAG AUGC--UAUG CUAA-GCUGG Aua------- ---------- -------agc 9601 uaauuuuuua auuaaaauuu (uuuagc--u -uaaa)g-aa -uu-agaagc uuuUUAG--c 9661 aacUC--G-- -UUUCU-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- ---------a auaguau|UU 9961 UAG(AAGACU A--)CUAAGU U--------- ---------- ---------- ------aauu 10021 u|gaagguag ---------- ---------- ---------- ---------- ---------- 10081 ---------- ----cuguua uag------- ---------- --------(- ---------- 10141 --------gg cccuuaacgg g)c-gua--- ---------- ---------- ---------- 10201 ----ccagcu c|c|cc-uua aaaaa----- ---------- ---------- -----auacu 10261 a--------- ---------- ---------- -agacucuua uuauuauuau au-------- 10321 --------|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.P.prima 10775 bp RNA RNA ~?~???? DEFINITION mitochondria,Paramecium primaurelia 7S+20S. ACCESSION No information KEYWORDS No information. SOURCE mitochondria,Paramecium primaurelia 7S+20S. ORGANISM mitochondria,Paramecium primaurelia 7S+20S. REFERENCE 1 (bases 1 to 40469) AUTHORS No information JOURNAL 5173-5181 STANDARD No information COMMENTS Organism information Culture collection: ? Sequence information (bases 1 to 10775) Corresponding GenBank entry: K00634 Phylo:Mitochondria,Protozoan,Paramecium Updated sequence from M. Schnare's comments BASE COUNT 860 a 374 c 542 g 794 t 8205 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~----- -----uuuga agucu----- ---------- ---------- 241 ---------- ---------- ---------- -----aaccA AGCACUAGA- ----CGGAUG 301 |CCU--AAA| AAUCUUGG-U U|gagggcgu aa-------- -----auau| -aaau(--ac 361 gag------) a|uuuguau- gUAAGC-|UU --uuuuu(-- ---------- ---------- 421 ugauau-)au aaaa-----A UGCUUU---- ggaugug-ca acaac----- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ccuuaaAAAU |UUUAUGAAG 841 CGA(AACA)U CGUAGUA--- -AUAAA---- ---------- -----uc--- ---uaaaaca 901 uAAAUC(-AA CU)GA-G-AU |GUU-AA-A- -GUAA-C(-G GUGA)GUGAA --acaaagu- 961 -AGCUCA<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- -aaaauuaaa agaaggggcu gaacuacuu< ---------- ---------- 1261 ---------- ---------- ---------> (ggaa--)aa guag------ GC-|U(ACA) 1321 G--AGGG(UG AUAGC)CCCg ua--agcuuu u--------- ---------- ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- ---GAGUAUA UAUUAU(--- ---------- 1561 uaacaaa)AU AAUAUGGAAA ------uguu u(-uuca-a) -aaaaaa--A AGCUA--AUA 1621 ---AAACCAA A-UU-UUGAU AGAA-AA--- -UAAGUACC( -GUGA-)GGG ---AAA-GG- 1681 UG-------- ---------- ---------- ---------- ---------- ---------- 1741 AAAAGAAAUU U(-gua---) GAAU------ ---------- ---------g cuuaAAAGA- 1801 UUCUG-AAAU CUAG-UGC-A G-<------- ---------- ---------- ---------- 1861 ----->UGAA ACAGUUAAAG C-------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (----guguu 2041 --)------- GUUUUAAC-G UACCUU(UU- GUAUA)AUGG |GCC-AACUA GU-----UU- 2101 AUAAAAUUAG CGA--gc--- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- uuuaucaaau c)-------- -----g-cGU 2521 AAU-(-GAAA )--AU----- --(------) ---------- ---------G UUAAU-UUUA 2701 UAA-GACCCG AA-GUCAA-G UG-AUCUAAU CAU-GGC-UA GGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----agaag) ---------- 2821 --AUCGAA-C CC-AUAAAU( GUUGCAA-A) AUUU-CGGGA --GAAGCUG- UGAUUAG-GG 2881 GU(G-AAAG) GCU-AAUC-A A-ACUUGACG AUAGCU-GGU UUUUC--GCG AA-AUC-UAU 2941 (-CUAC)GUA GA-GU-AUUU uuuU------ ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- --------uc UUU|-UGUGC 3061 G|GGGUAG|U GUAAUCU--u uu-cuu--aa gaaga---(u cuga----)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->---uc uu--uu-uuc 3301 gug--a--AG AAUCUUCC-- AAUA|-CGCA -U-U---AAA ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -au---aa-u -AAAUAAAAC GGACU--GA- GA-GU(-GCA 3481 AAG)AUUCUU GG-UC----G AGAGGG(AAA -CAG)CCC-A GACCG-A-AC -GA-UAA--- 3541 --AGU-GCAU -AAA-CA-A- UGCGAAGUA- ---------- -----aaag- aauuuuuuuu 3601 aaa------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- aaaau-AUUG G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAGGU-A GGC(UUAGAA 3781 UC-A)-GCCA -GCCU|U(U- AA)A|GAAAG C(--GAAACA )GC|-UCAC- CAAUAGuaa-aa-a -ca-auu|-u uuaa------ ---------- ---------- ----auuaua 3961 GCGCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ----AAGCAU UGU------- ---------- ---------- ---------- 4081 -------|AC UGAA--GCG| G--C-GG|G- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 aacu--)--- ---------- -C-----GGU AGCGA-AA|- CG-UUUUGUA G---GUCGUU 4501 G--------A AGGUU-UAUU (GAAA---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->AA UAG--GCU-G G|AGAU---| AUCAAAAUUG AUAAUGU-UG 4681 GC|AUGAGUA -AUG--GAC- AAA-AU-GU- (ucaaa---- ---------- ---------- 4741 ---------- -----)-U-C AUUUU-|UGU U-UGAU-AAG UUA--GGGUU -|----GCUU 4801 UGUUUu--GA ---------- ----(--UCA UC)U-U|-AC AAAGUG---- ---------- 4861 ---UGAUU-- -CGGCCUCUA A-U-U-U--- uuuAAAU(-a uaa------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-auuu---- uu---A-AAG AU-GAGGU-- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ------|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---|------ ---------- ---------- ---------- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- -ACCGUA|CU 6481 ---AACACU- -(AACACA)A G|UACUU-UA GUC-(GAG-C A-----)-GA UGACGACAG| 6541 |--AAGAG-C U--AAUGAUA -UUGA-AGGA ACUCGGCAAA AUUACU-UUG UAAC(UUCG- 6601 )GGAUAA-AA AGU|gc---- ---------- -----(guca ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- ---------- ---------- 6781 --gc|a(aac )aaaaaaaug GGGGGUAG|C GA---CUG-U UU(ACUAA)A AA-CAUA-AG 6841 AUUUUG|CA- -AAAUU---- ---------- (--uaau--- ------)--- ---------- 6901 UAUGAUGUA- UAA-AAUCUG ACUCCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-GU|G UUGUCA-UGC AAAGUU-UU- 7021 --AACGGu-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------u agc)----gC UGUU--GAUA A-CAAGCA-| 7141 GC-AAUA-AA C-|GG-C|-G -GCCAU-(AA CUCUG)AUGG UC|C(UAA)- GG-UAGCAAA 7201 AUC-CC-U-U |GACGGG(-U AAGU-)UCCG UC|CU-GCAC GAAUGGAGUA A-CGACUGCC 7261 CU-------- ---------- -------ACU GUCUCCAAUA UCAG-CU-CU ----AUGAAA 7321 UU|G|AAUUU GC-UG(U-GA AGAUG)CAGC UU-----UUU ACAACUAGAC GGAAAG-ACC 7381 CUAUGC-|-A CCUUU--ACU GA|--U-GCN AGG--AACU| <--------- ---------- 7441 ---------- ---------- --->AAAGA- GA-----UAU -Acuggaga- ua----aauU 7501 AAGGUAGGA- -gu------- ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----uaa a)-------- --------uc 7681 gcAAUUGAAA AACUACU|u- ----cucuu- u-U-A-CGUC UCUU-Cau-- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------uuua cuUUU-C-UG -GCU-GU-UA GUUUAACUG( 8161 GGG)CG-GU- U|GCCUCC(- --------UA AAAAGUAAC- )GGAG-GU|G |A|GCAU-|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->A-AAgUUA 8401 -CG|--CU-- uuguga (auuuu---- )uuuucgcaa aa-------- ---------- 8701 ---------- ---------- ---------- ---ugAG|uu (-|-AAUA)a aac-uGC-GU 8761 A-AU-UUGAU UAAAU-UAC( -agacua--- )GUAAU-UUA G--------- ---------- 8821 ---------- --------GG GC-------- ---(uuauu- -)-------- ----GCC-UG 8881 C|---UAUAA UGAUC-CGGU GU-U------ ---------- UUU(------ ---------- 8941 ---------- ---------- ---------- ---------- ----UUUUGA AU)AA|GACA 9001 UCGCUCAAC- |GAAUAAAAG GUACGC|UAG G|GAUAACAG |G-CUU-A-U AAAUUCUGAG 9061 AG(U--UCCU )AUUAAAGAA --UUUGUUUG GC-ACCUCGA UGUC|GG--C U|C|AUCAC| 9121 AU-CC-UGGU GG-UG(--CA -GA)AUCUGC CAAG-GGU|U UGGC(UGUUC )GCCAA-UUA 9181 A--AGUGGU- --ACGUGAGC UGGGUUUAAA AC|GU-U(GU GA)GACAGUU UGGUCCCUAU 9241 CU|GUUGU-A GA|A|<---- ---------- ---------- ---------- ---------- 9301 >UUAAG-AAA CG-AGG-CUG AGA-UCGGAU GC--(CAGU- AC(-GAGA)G GACC-)GAUU 9361 A--GA-<--- ---------- ---------- -------->A CUAGCCU-CU GGUUCGGCAU 9421 C|-UAC-UUU (aaaua)<-- ---------- ---------- ---------- ---------- 9481 ---------- ---------- ---------- ---------- ---------- ---------> 9541 AAG-GUAUAG AAGC--UACG CUAA-GCUGG Aua------- ---------- -------ggc 9601 uaauuuuuua auuaaaguuu (uuuagc--u -ugaa)u-aa -uu-agaagc ccuUUAG--c 9661 aucUC--G-- -UUUCU-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- ---------a auaauau|UU 9961 UAG(AAGACU A--)CUAAAU U--------- ---------- ---------- ------aauu 10021 u|gaaguuug ---------- ---------- ---------- ---------- ---------- 10081 ---------- ----cuguua uag------- ---------- --------(- ---------- 10141 --------gg cucuuuacga g)c-gua--- ---------- ---------- ---------- 10201 ----ccagcu u|u|cu-uua aaaaa----- ---------- ---------- -----auauu 10261 a--------- ---------- ---------- -agacucuua uuauuauuau au-------- 10321 --------|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.P.tetra 10775 bp RNA RNA ~?~???? DEFINITION mitochondria,Paramecium tetraurelia 7S+20S. ACCESSION No information KEYWORDS No information. SOURCE mitochondria,Paramecium tetraurelia 7S+20S. ORGANISM mitochondria,Paramecium tetraurelia 7S+20S. REFERENCE 1 (bases 1 to 40469) AUTHORS No information JOURNAL 5173-5181 STANDARD No information COMMENTS Organism information Culture collection: ? Sequence information (bases 1 to 10775) Corresponding GenBank entry: K01749 Phylo:Mitochondria,Protozoan,Paramecium Modified from M. Schnares comments BASE COUNT 854 a 377 c 544 g 793 t 8207 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~----- -----uuugc agucu----- ---------- ---------- 241 ---------- ---------- ---------- -----aacaA AGCACUAGA- ----CGGAUG 301 |CCU--AAA| AAUCUUGG-U U|gagggcgu aa-------- -----aucu| -aaau(--ac 361 gau------) a|uuuguau- gUAAGC-|UU --ucuuu(-- ---------- ---------- 421 ugauau-)au agaa-----U UGCUUA---- ggaugua-ca agggc----- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ccuugaAAAU |UUUAUGAAG 841 CGA(AACA)U CGUAGUA--- -AUAAA---- ---------- -----uc--- ---uaaaaca 901 uAAUUC(-AA CU)GA-G-AU |GUU-AA-A- -GUAA-C(-G GUGA)GUGAA --acaaagu- 961 -AGCUCA<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- -aaaauuaga aaagagggcu gaauuacuu< ---------- ---------- 1261 ---------- ---------- ---------> (ggaa--)aa guaa------ GC-|U(ACA) 1321 G--UGGG(UG AUAGC)CCCg ua--agcuuu u--------- ---------- ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- ---GAGUAUA UAUUAU(--- ---------- 1561 uaacaaa)AU AAUAUAGAAA ------uguu u(-uuca-a) -aaaaaa--A AGCUA--AUA 1621 ---AAACCAA A-UU-UUGAU AGAA-AA--- -UAAGUACC( -GUGA-)GGG ---AAA-GG- 1681 UG-------- ---------- ---------- ---------- ---------- ---------- 1741 AAAAGAAAUU U(-gua---) GAAU------ ---------- ---------g uuuaAAAGA- 1801 UUCUG-AAAU CUAG-UGC-A G-<------- ---------- ---------- ---------- 1861 ----->UGAA ACAGUUAAAG C-------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (----guguu 2041 --)------- GUUUUAAC-G UACCUU(UU- GUAUA)AUGG |GCC-AACUA GU-----UU- 2101 AUAAAAUUAG CGA--gc--- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- -uuaucaaau c)-------- -----g-cGU 2521 AAU-(-GAAA )--AU----- --(------) ---------- ---------G UUAAU-UUUA 2701 UAA-GACCCG AA-GUCAA-G UG-AUCUAAU CAU-GGC-UA GGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----agaag) ---------- 2821 --AUCGAA-C CC-AUAAAU( GUUGCAA-A) AUUU-CGGGA --GAAGCUG- UGAUUAG-GG 2881 GU(G-AAAG) GCU-AAUC-A A-ACUUGACG AUAGCU-GGU UUUUC--GCG AA-AUC-UAU 2941 (-CUAC)GUA GA-GU-AUUU uuuU------ ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- --------uc UUU|-UGUGC 3061 G|GGGUAG|U GUAAUCU--u uu-cuu--aa gaaga---(u cuga----)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->---uc uu--uu-uuc 3301 gug--a--AG AAUCUUCC-- AAUA|-CGCA -U-U---AAA ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -au---aa-u -AAAUAAAAC GGACU--GA- GA-GU(-GCA 3481 AAG)AUUCUU GG-UC----G AGAGGG(AAA -CAG)CCC-A GACCG-U-AC -GA-UAA--- 3541 --AGU-GCAU -AAA-CA-A- UGCGAAGUA- ---------- -----aaag- aauuguuuuu 3601 aaa------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- aaaau-AUCG G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAGGU-A GGC(UUAGAA 3781 UC-A)-GCCA -GCCU|U(U- AA)A|GAAAG C(--GUAACA )GC|-UCAC- CAAUAGuaa-aa-a -ua-auu|-u uuaa------ ---------- ---------- ----auuaaa 3961 GCGCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ----AAGCAU UGU------- ---------- ---------- ---------- 4081 -------|AC UGAA--GCG| G--C-GG|G- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 aacu--)--- ---------- -C-----GGU AGCGA-AA|- CG-UUUUGUA G---GUUGUU 4501 G--------A AGGUU-UAUU (GAGA---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->AA UAG--GCU-G G|AGAU---| AUCAAAAUUG AUAAUGU-UG 4681 GC|AUGAGUA -AUA--GAC- AAA-AU-GU- (ucaaa---- ---------- ---------- 4741 ---------- -----)-U-C AUUUU-|UGU U-UGAU-AAG UUA--GGGUU -|----GCUU 4801 UGUUUu--GA ---------- ----(--UCA UC)U-U|-AC AAAGUG---- ---------- 4861 ---UGAUC-- -CGGUCUCUA A-U-U-U--- uuuAAAU(-a gau------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-auuu---- uu---A-AAG AU-GAGCU-- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ------|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---|------ ---------- ---------- ---------- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- -ACCGUA|CU 6481 ---AACACU- -(AACGCA)A G|UACUU-UA GUC-(GAG-C A-----)-GA UGACGACAA| 6541 |--AAGAG-C U--AAUGAUA -UUGA-AGGA ACUCGGCAAA AUUACU-UUG UAAC(UUCG- 6601 )GGAUAA-AA AGU|gc---- ---------- -----(guca ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- ---------- ---------- 6781 --gc|a(aac )aaaaaaaug GGGGGUAG|C GA---CUG-U UU(ACUAA)A AA-CAUA-AG 6841 AUUUUG|CA- -AAAUU---- ---------- (--uaau--- ------)--- ---------- 6901 UAUGAUGUA- UAA-AAUCUG ACUCCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-GU|G UUGUCA-UGC AAAGUU-UU- 7021 --AACGGu-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------u agc)----gC UGUU--GAUA A-CAAGCA-| 7141 GC-AAUA-AA C-|GG-C|-G -GCCAU-(AA CUCUG)AUGG UC|C(UAA)- GG-UAGCAAA 7201 AUC-CC-U-U |GACGGG(-U AAGU-)UCCG UC|CU-GCAC GAAUGGAGUA A-CGACUGCC 7261 CU-------- ---------- -------ACU GUCUCCAAUA UCAG-CU-CU ----AUGAAA 7321 UU|G|AAUUU GC-UG(U-GA AGAUG)CAGC UU-----UUU ACAACUAGAC GGAAAG-ACC 7381 CUAUGC-|-A CCUUU--ACU GA|--U-GCU AGG--AACU| <--------- ---------- 7441 ---------- ---------- --->AAAGG- GA-----UAU -Acuggaga- ua----aauU 7501 AAGGUAGGA- -gu------- ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----uaa a)-------- --------uc 7681 gcAAUUGAAA AACUACU|u- ----cucuu- u-U-A-CGUC UCUU-Cau-- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------uuua cuUUU-C-UG -GCU-GU-UA GUUUAACUG( 8161 GGG)CG-GU- U|GCCUCC(- --------UA AAAAGUAAC- )GGAG-GU|G |A|GCAU-|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->A-AAgUUA 8401 -CG|--CU-- uuguga (auuuu---- )ucuuugcaa aa-------- ---------- 8701 ---------- ---------- ---------- ---ugAG|uu (-|-AAUA)a aac-uGC-GU 8761 A-AU-UUGAU UAAAU-UAC( -aaacua--- )GUAAU-UUA G--------- ---------- 8821 ---------- --------GG GC-------- ---(uaauu- -)-------- ----GCC-UG 8881 C|---UAUAA UGAUC-CGGU GU-U------ ---------- UUU(------ ---------- 8941 ---------- ---------- ---------- ---------- ----UUUUGA AU)AA|GACA 9001 UCGCUCAAC- |GAAUAAAAG GUACGC|UAG G|GAUAACAG |G-CUU-A-U AAAUUCUGAG 9061 AG(U--UCCU )AUUAAAGAA --UUUGUUUG GC-ACCUCGA UGUC|GG--C U|C|AUCAC| 9121 AU-CU-UGGU GG-UG(--CA -GA)AUCUGC CAAG-GGU|U UGGC(UGUUC )GCCAA-UUA 9181 A--AGUGGU- --ACGUGAGC UGGGUUUAAA AC|GU-U(GU GA)GACAGUU UGGUCCCUAU 9241 CU|GUUGU-A GA|A|<---- ---------- ---------- ---------- ---------- 9301 >UUAAG-AAA CG-AGG-CUG AGA-UCG-AC GC--(CAGU- AC(-GAGA)G GACC-)GACU 9361 A--GA-<--- ---------- ---------- -------->A CUAGCCU-CU GGUUCGGGAU 9421 C|-UAC-UUU (aaaua)<-- ---------- ---------- ---------- ---------- 9481 ---------- ---------- ---------- ---------- ---------- ---------> 9541 AAG-GUAUAG AUGC--UAUG CUAA-GCUGG Aua------- ---------- -------agc 9601 uaauuuuuua auuaaaauuu (uuuagc--u -uaaa)g-aa -uu-agaagc uuuUUAG--c 9661 aacUC--G-- -UUUCU-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- ---------a auaguau|UU 9961 UAG(AAGACU A--)CUAAGU U--------- ---------- ---------- ------aauu 10021 u|gaagguag ---------- ---------- ---------- ---------- ---------- 10081 ---------- ----cuguua uag------- ---------- --------(- ---------- 10141 --------gg cccuuaacgg g)c-gua--- ---------- ---------- ---------- 10201 ----ccagcu c|c|cc-uua aaaaa----- ---------- ---------- -----auacu 10261 a--------- ---------- ---------- -agacucuua uuauuauuau au-------- 10321 --------|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.T.pyr.1 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Tetrahymena pyriformis. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Tetrahymena pyriformis. ORGANISM Mitochondria Tetrahymena pyriformis. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: M58011 BASE COUNT 997 a 280 c 414 g 904 t 8180 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~GUA-G UAAA------ -aau------ ---------- ---------- 241 ---------- ---------- ---------- -----aauaA AGCAUUAAA- ----UGGAUG 301 |CCU--AGA| AUU-UAAA-U U|uuuucg-- ---------- -----uaaa| caaau(-uua 361 cgau-----) a|ucuauuu- aGUAAAU|Aa u-auauu(-- ---------- ---------- 421 gauauu-)uu uauu-----U AUUUGC---A AUUA-au--- -agau----- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->u aaaaauUAAU |UUAACGAAG 841 UGA(AACA)U CACAGUA--- -GUUAU---- ---------- ---------- ----UUUUAA 901 AAACUC(-AA UU)GA-G-AA |UAG-UAU-- ---AG-U(-G GUGA)GCUUA --UACUAUA- 961 -AGUUUU------ 1201 ---------- ---------- ----aaaauu gaaaauuuu< ---------- ---------- 1261 ---------- ---------- ---------> (agaa--)ua aauu------ AC-|C(AAA) 1321 G--UAGG(UG AAAGU)CCAg ua--aauuuu u--------- ---------- ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- ---UAGUAAA UUUCAA(--- ---------- 1561 uaaguuu)UU GAAAUUGAAA ----auUAGA A(AUCUA-C) -UUCUA---A AACUU--AAA 1621 ---AAAUUUA A-AU-UCUAU AGUA-AA--- --AAGUACC( -GCGA-)GGG ---AAA-GG- 1681 UG-------- ---------- ---------- ---------- ---------- ---------- 1741 AAAAG--auu -(-uuu---) -aau------ ---------- --------au cuuAAAAGA- 1801 ACCUA-AAAU UUAA-UGC-U A-<------- ---------- ---------- ---------- 1861 ----->-AAU ACAGUUAAGG C-------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (----uuuau 2041 --)------- GUUUUAAC-G UACCUU(UU- GCAUA)AUGG |GCU-AGCGA GU-----UU- 2101 AUAUAAUUAG CGA--guaau u-uau--(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- -----aauaa a)----auaa u-auua-cGA 2521 AUC-(-GAUA )--GA----- --(------) ---------- ---------G UUAAU-UAUA 2701 UAA-GACCCG AA-GCUAA-G UG-AUCUAAU UAU-GGU-UA GAUUAAG--- G-GU--A--- 2761 -(-------- ---------- ---------- ---------- -----uuua) ---UACCUAA 2821 GGAUCGAA-C UC-UUAAAU( GUUGCAA-A) AUUU-UGGGA --UAAACUG- UAAUUAG-GG 2881 GU(G-AAAG) GCU-UAUC-A A-ACUUAGUU AUAGCU-GGU UUUCC--ACG AA-ACC-UAU 2941 (-UUAA)GUA GG-GU-GAUA UUUU------ ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- --------au uau|-AAAAU 3061 U|AGGUUU|A AAUAACU--a ua-ucu--au aauuaa--(u aug-----)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->--uua au--ua--ua 3301 aaa-uu--AG UAUAUAAU-- AAUU|-AGUU -U-U---auu ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -u----AA-A -UAUU-AAUC AGACU--AU- UA-GC(-GCU 3481 AAG)GUUUAU AG-UC----A AGAGAG(AAA -CAG)CUC-A GAUUA-A-AC -AA-UAA--- 3541 --GGU-CUAC -AAA-AG-U- AAAUAAUUU- ---------- --uggaga-- UUGUUUUUAU 3601 U-A------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- UUAUC-AAUA A<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAUGU-A GGC(UUGGAA 3781 GC-A)-GCCA -UCAU|U(U- UA)A|AAAAG C(--GUAAAA )GC|-UUAA- UAUUGAUAU-AA-A -AA-UAA|-u cau-aaau-- ---------- ---------- ----gaaaau 3961 agauu----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- --aaUUUUUA CUU------- ---------- ---------- ---------- 4081 -------|AC CGAA--UUG| A--U-AA|AU C--------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(g 4441 aaa---)--- --------GA -U-----GGU AGUGG-AA|- CA-UUUUGUA U---AA-au- 4501 ---------A AAUAA-AAUU (GUGA---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->AA UUU--UAU-A U|c-UU---| AUCAAUAUAG AUAAUGC-UA 4681 GC|AUGAGUA -GUA--GAC- AUA-AU-GU- (gagaa---- ---------- ---------- 4741 ---------- -----)-U-C AUUAU-|CGC C-UGAU-GUA CAA--GGGUU -|----GCUA 4801 AAUUU---GA ---------- ----(--UAA UC)U-U|-AU UUAGUG---- ---------- 4861 ---UAAAU-- -CGGUUUCUA A-A-A-U--- -uuAAAU(-G UAU------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-auuu---- uu---A-UUG AU-GA-AUA- CGAA(----- ---------- ---------- 5041 ---------- --auauaaaa ----)UUCUU |---AA|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---|------ ---------- ---------- ---------- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ---<------ 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---uaaucua uuaaauauau uacauaaaau uuuuuguaau auauuuauuu aauggauuag 6421 uugcuggaaa uguuuauauu uuuuuu>--- ---------- ---------- -ACCGUA|CU 6481 ---AACUCU- -(AACACA)A G|UGUAC-AA GUA-(GAA-U A-----)-UA UAAUGGCGA| 6541 |--AGGAG-U A--AAAAGUA -UUGA-AGGA ACUAGGCAAA UUGACU-CUG UAAC(UUCG- 6601 )GGAGAA-AG AGG|GCU--- ---------- -----(uua- ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- ---------- ---------- 6781 -AGC|a(acu )a--aaaaGA GAGAGUAG|C GA---CUG-U UU(AAUAA)A AA-CAUA-AG 6841 AUUUUG|CU- -AAAUU---- ---------- (--uaaa--- ------)--- ---------- 6901 UACGAAGUA- UAA-AAUCUG ACACCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-GU|G CUGCAA-GGU GAACAA-AU- 7021 --UUUGGu-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------a aac)----gC UAAA--AU-U U-UAAACC-| 7141 CC-AGUA-AA C-|GG-C|-G -GCCGU-(AA CCCUG)ACGG UC|C(UAA)- GG-UAGCAAA 7201 AUU-CC-U-U |GGCGGG(-U AAGU-)UCCG UC|CU-GCAU GAAUGGUGUA A-CGACUGCU 7261 CU-------- ---------- -------GCU GUCUCCAAUA CUAG-CU-CU ----ACGAAA 7321 UU|G|AAUUU UC-CG(U-GA AGAUG)CGAC AAU----AUU ACAACUAGAC GGGAAG-ACC 7381 CUAUGC-|-A CCUUU--ACU GU|--U-AUC UGU--AAAU| <--------- ---------- 7441 ---------- ---------- --->AAUUU- UU-----UUU -UAUAAUua- acu---ag-a 7501 caAGUAGGA- -AAU------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----uua u)-------- -------AUU 7681 AAAAAUGGAA AACUACU|u- ----aAUUA- U-A-U-UUAA AAAU-UAAAA ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------auuu ugUUA-U-AG -AAA-GA-CA GUUUGACUG( 8161 GGG)CG-GU- C|UCCUCC(- --------UA AAAAGUAAC- )GGAG-GA|G |U|AUAA-|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->A-AA-CUC 8401 -GG|ggua-- ucuua-<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (uuuuaau-- )-----UAAG au-------- ---------- 8701 ---------- ---------- ---------- --caaua|UU (A|AAAUG)A AUUUUAC-UG 8761 A-GU-UUGAU UAGAG-UAC( -uuacaa--- )GUAUU-CUA A--------- ---------- 8821 ---------- --------GG AU-------- ---(AUAU-- -)-------- ----GUC-UA 8881 U|---CAUAU UGACC-CGAU AU-A------ ---------- AUU(------ ---------- 8941 ---------- ---------- ---------- ---------- ----UUGUAG AA)AA|UAUA 9001 UCGAUCAAC- |GAAUAAAAG GUACGC|UAG G|GAUAACAG |G-CUU-A-U GAGUUUUGAG 9061 AG(U--UCUU )AUUAAUAAA --CUCGUUUG GC-ACCUCGA UGUC|GG--C U|C|AUCAC| 9121 AU-CC-UGAU GG-UG(--GA -CA)AUCUAU CAAG-GGU|C CGGC(UGUUC )GCCGG-UUA 9181 A--AGUGGU- --ACGUGAGC UGGGUUUAAA AC|GU-C(GU GA)GACAGUU UGGUCCCUAU 9241 CU|GUUGU-A AU|U|<---- ---------- ---------- ---------- ---------- 9301 >AUAAG-AAA AU-AAA-UAA GAA-UUA-AC UU--(UAGU- AC(-GAGA)G GACU-)AGGA 9361 A--AA-<--- ---------- ---------- -------->U UUAAUCA-CU GGUUUGAAAA 9421 U|-UAU-UUU (-----) 9541 AAA-GUAUGG UUUU--UAAG CUAC-AUUAA A-C------- ---------- -------AAA 9601 ---------- -AUAAUUGCU (GAAUAU--U AUAUA)A-GC -AA--GAAUU UAACUUA--- 9661 UAUUA--U-- -UUUCU-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- ---------a auaaauu|UU 9961 UUA(AAGACU A--)UAUUAU U--------- ---------- ---------- ------UAAG 10021 U|UUUUA-UA ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---UAAGUGU AGU------- ---------- --------(- ---------- 10141 ---------- -------uau a)ACUAA--- ---------- ---------- ---------- 10201 ----CGAAUA U|A|UAAAAA ACUua-u--- ---------- ---------- -----aauuu 10261 a--------- ---------- ---------- ---------- ---AUA---- ---UUUACUA 10321 CAGUU---|U AGUUUAUA~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.T.pyr.2 10775 bp RNA RNA 11-JAN-191 DEFINITION Tetrahymena pyriformis. ACCESSION No information KEYWORDS No information. SOURCE Tetrahymena pyriformis. ORGANISM Tetrahymena pyriformis. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: M58010 BASE COUNT 994 a 282 c 416 g 903 t 8180 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~GUA-G UAAA------ -aau------ ---------- ---------- 241 ---------- ---------- ---------- -----aauaA AGCAUUAAA- ----UGGAUG 301 |CCU--AGA| AUU-UAAA-U U|uuuucg-- ---------- -----uaaa| caaau(-uua 361 cgau-----) a|ucuauuu- aGUAAAU|Aa u-auauu(-- ---------- ---------- 421 gauauu-)uu uauu-----U AUUUGC---A AUUA-au--- -agau----- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->u aaaaauUAAU |UUAACGAAG 841 UGA(AACA)U CACAGUA--- -GUUAU---- ---------- ---------- ----UUUUAA 901 AAACUC(-AA UU)GA-G-AG |UAG-UAU-- ---AG-U(-G GUGA)GCUUA --UACUAUA- 961 -AGUUUU------ 1201 ---------- ---------- ----aaaauu gaaaauuuu< ---------- ---------- 1261 ---------- ---------- ---------> (agaa--)ua aauu------ AC-|C(AAA) 1321 G--UAGG(UG AAAGU)CCAg ua--aauuuu u--------- ---------- ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- ---UAGUAAA UUUCAA(--- ---------- 1561 uaaguuu)UU GAAAUUGAAA ----auUAGA A(AUCUA-C) -UUCUA---A AACUU--AAA 1621 ---AAAUUUA A-AU-UCUAU AGUA-AA--- --AAGUACC( -GCGA-)GGG ---AAA-GG- 1681 UG-------- ---------- ---------- ---------- ---------- ---------- 1741 AAAAG--auu -(-uuu---) -aau------ ---------- --------au cuuAAAAGA- 1801 ACCUA-AAAU UUAA-UGC-U A-<------- ---------- ---------- ---------- 1861 ----->-AAU ACAGUUAAGG C-------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (----uuuau 2041 --)------- GUUUUAAC-G UACCUU(UU- GCAUA)AUGG |GCU-AGCGA GU-----UU- 2101 AUAUAAUUAG CGA--guaau u-uau--(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- -----aauaa a)----auaa u-auua-cGA 2521 AUC-(-GAUA )--GA----- --(------) ---------- ---------G UUAAU-UAUA 2701 UAA-GACCCG AA-GCUAA-G UG-AUCUAAU UAU-GGU-UA GAUUAAG--- G-GU--A--- 2761 -(-------- ---------- ---------- ---------- -----uuua) ---UACCUAA 2821 GGAUCGAA-C UC-UUAAAU( GUUGCAA-A) AUUU-UGGGA --UAAACUG- UAAUUAG-GG 2881 GU(G-AAAG) GCU-UAUC-A A-ACUUAGUU AUAGCU-GGU UUUCC--ACG AA-ACC-UAU 2941 (-UUAA)GUA GG-GU-GAUA UUUU------ ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- --------au uau|-AAAAU 3061 U|AGGUUU|A AAUAACU--a ua-ucu--au aauuaa--(u aug-----)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->--uua au--ua--ua 3301 aaa-uu--AG UAUAUAAU-- AAUU|-AGUU -U-U---auu ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -u----AG-A -UAUU-AAUC AGACU--AU- UA-GC(-GCU 3481 AAG)GUUUAU AG-UC----A AGAGAG(AAA -CAG)CUC-A GAUUA-A-AC -AA-UAA--- 3541 --GGU-CUAC -AAA-AG-U- AAAUAAUUU- ---------- --uggaga-- UUGUUUUUAU 3601 U-A------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- UUAUC-AAUA A<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAUGU-A GGC(UUGGAA 3781 GC-A)-GCCA -UCAU|U(U- UA)A|AAAAG C(--GUAAAA )GC|-UUAA- UAUUGAUAU-AA-A -AA-UAA|-u cau-aaau-- ---------- ---------- ----gaaaau 3961 agauu----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- --aaUUUUUA CUU------- ---------- ---------- ---------- 4081 -------|AC CGAA--UUG| A--U-AA|AU C--------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(g 4441 aaa---)--- --------GA -U-----GGU AGUGG-AA|- CA-UUUUGUA U---AA-au- 4501 ---------A AAUAA-AAUU (GUGA---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->AA UUU--UAU-A U|c-UU---| AUCAAUAUAG AUAAUGC-UA 4681 GC|AUGAGUA -GUA--GAC- AUA-AU-GU- (gagaa---- ---------- ---------- 4741 ---------- -----)-U-C AUUAU-|CGC C-UGAU-GUA CAA--GGGUU -|----GCUA 4801 AAUUU---GA ---------- ----(--UAA UC)U-U|-AU UUAGUG---- ---------- 4861 ---UAAAU-- -CGGUUUCUA A-A-A-U--- -uuAAAU(-G UAU------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-auuu---- uu---A-UUG AU-GA-AUA- CGAA(----- ---------- ---------- 5041 ---------- --auauaaaa ----)UUCUU |---AA|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---|------ ---------- ---------- ---------- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ---<------ 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---uaaucua uuaaauauau uacauaaaau uuuuuguaau auauuuauuu aauggauuag 6421 uugcuggaaa uguuuauauu uuuuuu>--- ---------- ---------- -ACCGUA|CU 6481 ---AACUCU- -(AACACA)A G|UGUAC-AA GUA-(GAA-U A-----)-UA UAAUGGCGA| 6541 |--AGGAG-U A--AAAAGUA -UUGA-AGGA ACUAGGCAAA UUGACU-CUG UAAC(UUCG- 6601 )GGAGAA-AG AGG|GCU--- ---------- -----(uua- ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- ---------- ---------- 6781 -AGC|a(acu )a--aaaaGA GAGAGUAG|C GA---CUG-U UU(AAUAA)A AA-CAUA-AG 6841 AUUUUG|CU- -AAAUU---- ---------- (--uaaa--- ------)--- ---------- 6901 UACGAAGUA- UAA-AAUCUG ACACCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-GU|G CUGCAA-GGU GAACAA-AU- 7021 --UUUGGu-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------a aac)----gC UAAA--AU-U U-UAAACC-| 7141 CC-AGUA-AA C-|GG-C|-G -GCCGU-(AA CCCUG)ACGG UC|C(UAA)- GG-UAGCAAA 7201 AUU-CC-U-U |GGCGGG(-U AAGU-)UCCG UC|CU-GCAU GAAUGGUGUA A-CGACUGCU 7261 CU-------- ---------- -------GCU GUCUCCAAUA CUAG-CU-CU ----ACGAAA 7321 UU|G|AAUUU UC-CG(U-GA AGAUG)CGAC AAU----AUU ACAACUAGAC GGGAAG-ACC 7381 CUAUGC-|-A CCUUU--ACU GU|--U-AUC UGU--AAAU| <--------- ---------- 7441 ---------- ---------- --->AAUUU- UU-----UUU -UAUAAUua- acu---ag-a 7501 caAGUAGGA- -AAU------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----uua u)-------- -------AUU 7681 AAAAAUGGAA AACUACU|u- ----aAUUA- U-A-U-UUAA AAAU-UAAAA ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------auuu ugUUA-U-AG -AAA-GA-CA GUUUGACUG( 8161 GGG)CG-GU- C|UCCUCC(- --------UA AAAAGUAAC- )GGAG-GA|G |U|AUAA-|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->A-AA-CUC 8401 -GG|ggua-- ucuua-<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (uuuuaau-- )-----UAAG au-------- ---------- 8701 ---------- ---------- ---------- --caaua|UU (A|AAAUG)A AUUUUAC-UG 8761 A-GU-UUGAU UAGAG-UAC( -uuacaa--- )GUAUU-CUA A--------- ---------- 8821 ---------- --------GG AU-------- ---(ACAU-- -)-------- ----GUC-UA 8881 U|---CAUAU UGACC-CGAU AU-A------ ---------- AUU(------ ---------- 8941 ---------- ---------- ---------- ---------- ----UUGUAG AA)AA|UAUA 9001 UCGAUCAAC- |GAAUAAAAG GUACGC|UAG G|GAUAACAG |G-CUU-A-U GAGUUUUGAG 9061 AG(U--UCUU )AUUAAUAAA --CUCGUUUG GC-ACCUCGA UGUC|GG--C U|C|AUCAC| 9121 AU-CC-UGAU GG-UG(--GA -CA)AUCUAU CAAG-GGU|C CGGC(UGUUC )GCCGG-UUA 9181 A--AGUGGU- --ACGUGAGC UGGGUUUAAA AC|GU-C(GU GA)GACAGUU UGGUCCCUAU 9241 CU|GUUGU-A AU|U|<---- ---------- ---------- ---------- ---------- 9301 >AUAAG-AAA AU-AAA-UAA GAA-UUA-AC UU--(UAGU- AC(-GAGA)G GACU-)AGGA 9361 A--AA-<--- ---------- ---------- -------->U UUAAUCA-CU GGUUUGAAAA 9421 U|-UAU-UUU (-----) 9541 AAA-GUAUGG UUUU--UAAG CUAC-AUUAA A-C------- ---------- -------AAA 9601 ---------- -AUAAUUGCU (GAAUAU--U AUAUA)A-GC -AA--GAAUU UAACUUA--- 9661 UAUUA--U-- -UUUCU-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- ---------a auaaauu|UU 9961 UUA(AAGACU A--)UAUUAU U--------- ---------- ---------- ------UAAG 10021 U|UUUUA-UA ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---UAAGUGU AGU------- ---------- --------(- ---------- 10141 ---------- -------uau a)ACUAA--- ---------- ---------- ---------- 10201 ----CGAAUA U|A|UAAAAA ACUua-u--- ---------- ---------- -----aauuu 10261 a--------- ---------- ---------- ---------- ---AUA---- ---UUUACUA 10321 CAGUU---|U AGUUUAUA~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (3)-FM-GRP 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (4)-FUNGI 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.S.pombe 10775 bp RNA RNA ~?~???? DEFINITION Mitochondria Schizosaccharomyces pombe. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Schizosaccharomyces pombe. ORGANISM Mitochondria Schizosaccharomyces pombe. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: X06597,X54421 Schizosaccharomyces pombe mt LSU rRNA Lang BF, Cedergren R, Gray MW (1987) The mitochondrial genome of the fission yeast, Schizosaccharomyces pombe. Sequence of the large-subunit ribosomal RNA gene, comparison of potential secondary structure in fungal mitochondrial large-subunit rRNAs and evolutionary considerations. Eur. J. Biochem. 169:527-537 BASE COUNT 1050 a 383 c 492 g 901 t 7949 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~aaugu-g uaau------ -uugaaucaa uuucuauccu uuuaaaaaua 241 caucauaaag uguacuuuuu uaaggauuua guuauUAAAG GAUUAAUUA- ----UGGAUU 301 |GCU--AAC| CAG-UUAA-U A|uuaag--- ---------- -----agga| -agcu(-u-u 361 uaa------) a|gcuuaau- ucagcaa|u- -------(-- ---------- ---------u 421 uuuua--)-- ---------a uuguugu-uu cuccuaa-ag g--------- -----(uaaa 481 )cca|----- --(cua--)- ---------- aaaagaaaga ac-------- -(-uuc-g)- 541 --------gg uuuuucuuua a--<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ---aauAAAC |UAGAGGAAC 841 UGA(AUCA)U CUUAGUA--- -CUCUA---- ---------- ---------- ---AGGAAAA 901 UAAAAU(-AA CA)AU-G-AU |UAU-UGUA- -GUAG-U(-G GCGA)ACGAA -UCAUUAAU- 961 -AGUCUA------ 1201 ---------- ---------- -uauuaaaaa aaauuuuu-< ---------- ---------- 1261 ---------- ---------- ---------> (-acca-)-a agaa------ ga-|g(aaa) 1321 a---aug(gg uucuu)cauu uu-------- ---------- ---------- u-uaAAGUAAA AUGGGA(--- ---------- 1561 --acuua)AC CUGUUUGAAU ----auUGGA G(AAccaaU) -CUCCAA--A GACUA-AAUA 1621 ---UA-UUAA C-UGAGUGAU AGUG-AA--- --GAGUACC( -GUAA-)GGG ---AAA-GC- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 -aAUG-AAAU AGUU-AAU-C U-<------- ---------- ---------- ---------- 1861 ----->AUAA GCGAAGAUAG Ugaau---<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (-uuuaaaua 2041 --)---aauu AUUAUCUU-G UACCUU(UU- GCAUA)AUGG |GUC-AGCAA GU-----UU- 2101 UAAUUAUUUG CAA------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 gcu-(-gaaa )--agc---- ---------- ---------- ------aaaG UAAAU-AAUU 2701 AAA-GACCCG AA-ACCUG-A CG-AUCUUAC CAU-GAA-CA GAUU------ ---------- 2761 -(-------- ---------- ---------- ---------- ----uuaag) ---------- 2821 -GAUCGAA-C CA-GUAAUC( GUUGCAA-A) GAUU-UUGGA --UGAUUUG- UGGUAAG-GG 2881 GU(G-AAAU) GCU-AAUC-G A-GUUAGGUG AUAGCU-GGU UGUCC--ACG AA-ACC-AUU 2941 (-UUAA)GAU GG-GC-ACUU CAAA<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->-- aac|-UAAAU 3061 G|AGGUAC|A GAAAUuu-AU UG-ccu---- ---------- ---------< u--------- 3121 ---------- -caaga-ag- ---------- ---------- ---------- ---------- 3181 ---------- -------(uu u-)------- ---------- ------uuuc -uuguua--- 3241 ---------- ------auag gggauc---u aaa-gauuua ccua>----- --------ag 3301 gCGuuAa-uu AAUCUCGG-- AAUA|-aauu -u-a--aaaa ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -agu--UU-G -AAGU-AGUU AGACA--AU- UG-GC(-GAU 3481 AAG)GUCAAU AG-UC----A AAAGAG(AAA -CAG)CUC-A GAUCA-A--A -GA-uuuaa- 3541 --AGU-UCCC -CAAUUU-A- AGUUAAGUG- --------AU UUAAAGAUA- GUCUUACUCC 3601 U-U------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AUUCA-AUAA G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->AAUAU-G GGC(UUGGAA 3781 AC-A)-GCCA -UUAU|C(U- AA)G|GAGUA C(--GUAAUA )GU|-UCAC- UUAUCCuGG-AG-A -AA-GGC|-A UCAAAAAU-- ---------- ---------- ----UUAACG 3961 GAUCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---uAAACUU AAU------- ---------- ---------- ---------- 4081 -------|AC UUAA--ACU| U--U-GG|CA Guauuu---- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 aa----)--- --aaaua-CU -G-----GGU AGUGG-AC|- CG-AUCUAUA U---AAAgau 4501 g--------A AGAUG-AACU (uuua---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->AG UUU--AUU-G G|AUUU---| AUUAGAUGCG AGAAUGC-UG 4681 AC|AUAAGUA -ACGU-AAA- AAA-AG-GU- (caaau---- ---------- ---------- 4741 ---------- -----)-U-C CUUUU-|CAC C-GAAA-ACU GAA--GGGUU -|----UUGA 4801 CUUAA---AA (----- --)U-U|-AA GUCAAA---- ---------- 4861 ---uaaagua aCAAUCUCUA A-G-C-U--- ---a---(au aaa------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >----u---- -----A-GUG AU-GAGUA-- ----(aaucu ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------u |aa<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- -cggaucuua aaaua----- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 ---- uauuCAGGAA ----AAUuau ccg<------ 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--u u----a---- ------uuuu aAUUGUA|CC 6481 C--UAAACC- -(GACACU)G G|UCAGU-UA AGA-(GAA-U A-----)-UC UUAAGGUGU| 6541 |---UGAG-A G--AACUAUG -CUUA-AGGA ACUCGGCAAA UUAGCU-CUG UUAC(UUCG- 6601 )GUAUAA-AG AGU|GUUCAU ---------- -----(-uau uuu)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->------ -------AUG 6781 -AAC|-(uca )a--uaaaGA GAACCCUA|C AA---CUG-U UU(ACUUA)A AA-CACA-GC 6841 ACAUUG|CC- -AAAAU---- ---------- (-uaaaaa-- ------)--- ---------- 6901 AUUAUAGUA- UAA-UGUGUG AGGUCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CU-CA-AU|G UCCUAU-GGU UAACAA-Uac 7021 --gaacuu-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------u aac)----ga guuu--ua-C G-GAACCC-| 7141 AG-GAUA-AA U-|AG-C|-G -GCUUU-(AA CUCUG)AGGG UC|C(UAA)- GG-UAGCGAA 7201 AUU-CC-U-U |GUCCGA(-U AAAU-)ACGG UC|CC-GCAU GAAUGACUUA A-UGAUAGGG 7261 UU-------- ---------- -------GCU GUCUCAAGCA CAGA-CU-CA ----GUGAAA 7321 UU|G|UAAUU GC-UG(U-GA AGAUA)CAGU GUU----CCC UCAGCUAGAC GGAAAG-ACC 7381 CUG-GC-|-A GCUUU--ACG AU|--A-GUU AAU--UAUU| gcuuu- au----cuau ----uuuug- uuc---AGUA 7501 UAGAGGuUA- -GUC------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(---guuu a)-------- -------GAC 7681 AAAAAUGAGA UAuCCUC|c- ----uuaa-- ----a-uaau aaag-aucuu uaaagu---- 7741 -----(---u uaa-)----- ---------- ---------- ---------- ----acu-<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->UGAC AUUAA-U-UA -AUU-GA-UC GUUUCUGUG( 8161 GGG)CG-CA- G|GCCUCA(- --------UA AAAAAUAAC- )UGAG-GU|A |U|CCUA-|< 8221 gaucuaua-- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->U-AA-UUU 8401 -GU|--cua- ------ (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- ----gac|GC (A|UAUAA)G CAU-AAA-UA 8761 G-GU-UAAAC UGAAA-GAC( -uaacaa--- )GUCGC-ACA G--------- ---------- 8821 ---------- --------AU AU-------- ---(GUAA-- -)-------- ----AUA-GG 8881 G|---UUAAA UGAUC-caca uu-gaaacac uaauuuagug UUU(------ ---------- 8941 ---------- ---------- ---------- ---------- ----GUAUGG AA)AA|CAAU 9001 GUGCUCAAU- |GAG-cgAAG UUACGC|CAG G|GAUAACAG |G-UUA-A-U AGAGAGCUAA 9061 AG(U--ACAA )AUCAAAUUC --UCUGUUUG AC-ACCUCGA UGUC|GA--C U|C|AACCU| 9121 AU-C--UCCG GU-UG(--UA -GC)AGAUUG GAAG-GGU|U AGAC(UGUUC )GUCUAUUUA 9181 A--AAGGUU- --ACGUGAGU UGGGUUAAAU CC|GU-C(GU AA)GACAGGA UGGUUCCUAU 9241 CU|ACUGA-G GG|A|<---- ---------- ---------- ---------- ---------- 9301 >AAAAU-AAG CA-AAU-UAA AAU-UUA-UC UU--(UUGU- AC(-GCAA)G GAUU-)UAGA 9361 U--AA-<--- ---------- ---------- -------->U UCAAUCU-CU AGUUUAACUA 9421 U|-UGU-UAC ------- 9541 GUA-GCACGG UAGU--AAAG CCAA-AUUGA ACA------- ---------- -------AAU 9601 ---------- --UAAAAACU (GAAAGC--A UCUCA)A-GU -UU-GAAAUU UA-UUUA--- 9661 -AAGA--G-- -CUUAU-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- ---------- --auuaa|GA 9961 AAG(UAGAAA A--)CUUUCc aa-aaggaca uc-------- ---------- ------cuUA 10021 G|GAuguaca ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---aauccuu auuuuaguaa aucauuguuu --------(a gauagauuua 10141 guuaauuuuu uaaccaaagg -)-------- ---------- ---------- ---------- 10201 -----gauua u|c|ucuUUG CUAau-u--- ---------- ---------- ----uuuuaa 10261 auaacuggaa auu------- ---------- ---------- -gccu----- -aauuacaca 10321 auuuuuuu|u ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.P.urtic 10775 bp RNA RNA 17-DEC-1994 DEFINITION Mitochondria Penicillium urticae str. NRRL2159A; S5 protein. ACCESSION D14567 KEYWORDS S5 protein. SOURCE Mitochondria Penicillium urticae str. NRRL2159A. ORGANISM Mitochondria Penicillium urticae. REFERENCE 1 (bases 1 to 6463) AUTHORS Yamamoto,H., Naruse,A. and Sekiguchi,J. TITLE Characterization and nucleotide sequence of the large mitochondrial rRNA gene of Penicillium urticae JOURNAL Unpublished (1993) STANDARD No information COMMENTS Organism information Culture collection: NRRL 2159A Sequence information (bases 1 to 10775) Corresponding GenBank entry: D14567 Submitted (02-MAR-1993) to DDBJ by: Junichi Sekiguchi Department of Applied Biology Shinshu University Faculty of Textile Science & Technology 3-15-1 Tokida, Ueda-shi Nagano 386 Japan Phone: 0268-22-1215 Fax: 0268-22-4079. NCBI gi: 602773 BASE COUNT 1671 a 538 c 746 g 1527 t 6293 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ aaaauuaaac 61 uaauguaaau acauuauagg uauuacaggu uaguguccgg ugguuggucg cuucauuugg 121 guuggagauu guuuauguuc gaaucauaau aaccugaaaa cuaauauagg cuuaauaaua 181 ugggccaaua aa>gauga-u auguac---- --cauaua-- --cc-ucuug a--------- 241 ----gaaa-- ---------- -ucaagacaa guauaUAAAG AAACUAUUA- ----UGGAUG 301 |GUU--AGC| UAU-AUAU-U U|caagaua- ---------- --aguauau| -cuag(ggaa 361 caacauaaa) c|uagaaau- cauagag-aa a-ucuaauua ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ----uaAGAC |AAAGUGAAU 841 UGA(AAUA)U CUUAGUA--- -ACUUU---- ---------- ---------- ---AGUAAAA 901 GAAAUC(-AA AC)GA-G-AU |UGU-UAU-- -UUGG-U(-G -UCU)UCUGA -AUAGCAAA- 961 -AGCCUA--AAGUAUA ACGGAA(--- ---------- 1561 ---aaaa)AU CUGUUGAAAA ----auAGGG G(AACCU-U) -CCUCUA--A GGCUA-AAAA 1621 ---AA-AUAU A-UAAGCGAU AGAG-UA--- -ACAGUACC( -GUGA-)GGG ---AAAUAC- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 -cCUG-AAAU AGUA-GUU-U U-<------- ---------- ---------- ---------- 1861 ----->AUAA GCAGCUCAAG Uua-----<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---aauuuua aauaaa---> (--------- 2041 --)-----ua AUAAGAGC-G UACCUU(UU- GCAUA)AUGG |GUC-AGCAA GU-----UA- 2101 AUUUUAGAUG CAA--guaa- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------c aucucuuuuc uaaaaauuau 2461 acauacuaaa uauguaauau uauacaaaaa augauugcua g)-------- ---uua-c-- 2521 ----(----- )-----uuau g-(aaaa--) -a-auga--- -----auuaG UAUCU-AGAA 2701 UUA-GACCCG AA-GGCUA-G UG-AUCUUAC CAU-GGU-CA GGGU------ u--------- 2761 -(-------- ---------- ---------- ---------- ----auaaa) ------a--- 2821 -GCCCGAA-C GG-GUUAUC( GUUGUAA-A) GAUA-UCCGA --UGAACUG- UGGUAAGUUA 2881 GU(G-AAAG) ACA-AAAC-U G-ACUAGU-- AUAGCU-GGU UUUCC--GCG AA-ACC-UAU 2941 (-GUAA)GUA GG-UA-AUUU AAUU<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->aa CAU|-CUUAG 3061 C|AGGUAC|A GAACUGugau cu-cg----- ---------- ---------< gacaa-uau- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- --------cu aag------- ---------- ---------- ---------- 3241 aua----uuu gucaacaucg ggggguug-u agugacuuua ccgg>----- ---------a 3301 gag-uau-uU GCACUCGG-- AAGG|-GCAA -A-G---AUG ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -aau--GU-U -AAAU-AAUC GGACA--UA- GU-GC(-GAU 3481 AAG)GUUGUA UG-UC----U AAAGGG(AAA -CAG)CCC-A GAACA-A--G AGU-UAA--- 3541 --GGU-UCCA -AAAUUA-U- UGUUAAGUG- --------AA AUUAAGGAU- GUUUUUUUUU 3601 A--------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AAACA-AUCA G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAAAU-A GGC(UUAGAA 3781 GC-G)-GCCA -UUUU|U(U- GA)A|GACCU C(--GUAACA )GA|-GCAC- UGAUUAuAG-GA-A -AA-AAC|-G CCGAAAAU-- ---------- ---------- ----UUAACG 3961 GAUCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ----AAAUAA UAU------- ---------- ---------- ---------- 4081 -------|AC CGAA--ACC| U--U-GU|AC Acaaa--gaa au---auuaa a-gc-uuuag 4141 uagga-gcuu auuguuauua augagu---- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- --aauug-UG -G-----GGU AGCGG-AA|- CA-UUGGAUU A---AAC--- 4501 ---------- ---------- (-------)< --aaaauauu aauauuuuuc uuaaaauauu 4561 aaaaaaaucu cgaauuaaug cacauuaaug aacacaauug caauagauug uguuuuuauc 4621 uacuauauga gaaucu->-- ---------- -|-GUU--a| AAUCCAAGAG AGAAUGC-UG 4681 AC|AUGAGUA -ACGA-AAA- AGG-CU---- (uuu------ ---------- ---------- 4741 ---------- -----)---- AGCCU-|CGC C-UGAA-GCU UAU--GGUU- -|-------- 4801 ---------- (----- --)---|--- ---------- ---------- 4861 ---------- -CGGUGUCUA AAA-A-A--- --auua-(au caaaaga--- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-uaau---- -----U-UUG AU-GAc--g- uuuu(auguu (uuuuuauau aau)aauacc 5041 ---------- ---------- ----)aaaac |-----|--- ---------- |---- -uuuuuu-ua auaac----- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 ---- uauacuggua ----aa-aaa aaa--- -uaua----- ---------- -ACCGUA|CC 6481 ua-GAAACU- -(AACUCA)A G|UAAGC-AA GUA-(GAG-A A-----)-UA CAAAGGCGU| 6541 |--UUGAG-A G--AACAAUC -AUUA-AGGA ACUCGGCAAA UUGACU-CUG UACC(UUCG- 6601 )GAAUAA-GG AGG|------ ---------- ---------- ---------- ---------- 6781 ----|A(UCA )U--GAAAUA AUGUUGUA|C GA---CUG-U UU(AAUAA)A AA-CACA-GC 6841 ACUCUG|CA- -AAGAU---- ---------- (--aaaaa-- ------)--- ---------- 6901 AUCAAAGUA- UUG-AGUGUG AUGUCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CA-AU|G UCGGCU-GGG UAACGG-Auc 7021 u-ACCUUg-a u-(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- --------ua uua)ac--UG AGGUuuUGAA G-GACACC-| 7141 CC-GAUU-AA U-|GG-C|-G -GCCUU-(AC CUAUG)AGGG UC|C(UAA)- GG-UAGCGAA 7201 AUA-CC-U-U |GGCCGU(-U AAAU-)GCGG UC|CU-GCAU GAAUGACUUA A-CGAUGCAA 7261 CA-------- ---------- -------GCU GUCUCGAUGA UUGU-CU-CA ----GUGAAA 7321 UU|G|GAAUA GC-AG(U-GC AGAUA)CUGU UUA----CCU CUAGAUAGAC GAGAAG-ACC 7381 CUAUGC-|-A GCUUU--ACU GU|--U-ACU AAU--UAUA| gagu-- ga-----aau -uuaggaUG- auuuauAGUG 7501 UAUAAGGUA- -GUU------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(---guuu a)-------- -------GAU 7681 AAUAAUGAAA CACCuuu|au ucgaauccu- u---a-uaua uacu-c---- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->--uu aaUGA-U-UA -GAA-GG-CA GUUUAUGCG( 8161 GGG)CA-CA- G|AUCCCA(- --------CA AAAAGUACC- )UGGGUAU|A |U|CCAA-|< 8221 -aguucauau uguaaacuug uauauuuaua uacaaauauu uuaauuuguu cuaauuauua 8281 uuauaauuau acaguuauua uucgauuaaa uucaauaauu auuuuuauuu uu-------- 8341 ---------- ---------- ---------- ---------- ---------- ->A-AG-UAA 8401 -GA|--UU-- uuaa-- (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- ----aAA|GU (U|UAAUG)G CUA-aau-cU 8761 U-GC-UUUAC UGUUU-GAC( -cuacaa--- )GUCUA-UCA G--------- ---------- 8821 ---------- --------UC GC-------- ---(GUAA-- -)-------- ----GCG-GG 8881 G|---CAU-A UGAUC-ACAA GA-U------ ---------- GCA(------ ---------- 8941 ---------- ---------- ---------- ---------- ----UUAAGG AA)AG|GUCU 9001 UGG-AUUAU- |AGA-AAAAG UUACGC|UAG G|GAUAACAG |G-CUA-AuU UGCGCAAGAG 9061 AG(U--ACAA )AUUGAGUGC --GCGGUUUG GC-ACCUCGA UGUC|GG--C U|U|AGCUC| 9121 AU-CC-UCAU GCAUG(--CA -GA)AAUCAU GAAG-GGU|U CGAC(UGUUC )GUCGA-UUA 9181 A--AGAGCU- --ACAUGAGC UGGGUUUAAU AC|GU-C(GU GA)GACAGUA UGGUUUCUAU 9241 CU|UCUAG-A GG|A|<---- ---------- ---------- ---------- ---------- 9301 >ACAUA-AAG UA-GAU-UAA AGA-uaG-CC CCu-(UCGU- AC(-GAAA)G GAGUu)GGGU 9361 a--u--<--- ---------- ---------- -------->A UUGAUCU-CU GGUUUACCUG 9421 U|-UGU-UUA ------- 9541 UAG-GCAUGG CAGG--AAAG CUAC-AUCAG UUA------- ---------- -------AAG 9601 ---------- -AUAAGUGUU (GAAAGC--A U-CUA)A-AC -GC-GAAGCA AACUUUA--- 9661 -ugaU--A-- -CUUAUu<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ------(--- )--------- -----ua|CG 9961 UAG(UAGAAC A--)CUACGa guauaauugu ua------ua uu-----uaa caauu-aaUA 10021 G|GCUUUagu ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---uguaagA AUG------- ---------- --------(- ---------- 10141 ---------- -------aaa a)CAUUu--- ---------- ---------- ---------- 10201 ----uuagau a|u|AAAGUA CUAau-u--- ---------- ---------- ----uuaagu 10261 uuaguauacu aaauauuauu aaauaucauu auaauauuuu auauguuaca auaaa|?gcc 10321 uuuuuagcau aaaaguaaug caaccguuuu guaaucggua gaagugaguu cgauacucgc 10381 auaaggcuaa auauauuuuu uuauuuaaag acccaauggu caagacuggu uaagacauaa 10441 cauuuucacu guuagugcgg gaguucaaau cucccuuggg uuaaaaaaaa uauaauaaaa 10501 gagauuagcu caguugguag agcugucgcu uuacacgcga aaggucaggu guucaaauca 10561 ccuaucucuu aaagcgaauu aauguaauag uaacauauau ggcucauguc cauauuauuu 10621 aggugcaauu ccuaaguucg cuaccaaaga cuauagcuua auugguuaaa gcgaaccacu 10681 caugaugguu ugaguaaaug uucaagucau uuuagucuua uuuaauccga gugcuggaac 10741 ugguagacag ucuuaacuua agcuu~~~~~ ||||| // LOCUS mt.E.nidul 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Emericella nidulans. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Emericella nidulans. ORGANISM Mitochondria Emericella nidulans. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: J01390,X06961 same as M24412 at the 5' end BASE COUNT 1178 a 363 c 544 g 1027 t 7663 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~gguga-u auauau---- --cauaua-- --ua-acuug a--------- 241 ----gaaa-- ---------- -ucaaggcua guauaUAAAG AAACUAUUA- ----UGGAUA 301 |AUU--AGC| UAU-AUAU-U A|aagaaau- ---------- ---aaauga| -cuag(-aua 361 a-au-----) c|uaggauu- cuaagaa-aa a-ucaaguaa ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- -----uAAAC |GAAGUGAAU 841 UGA(AAUA)U CUUAGUA--- -ACUUU---- ---------- ---------- ---AGGAAAA 901 GAAAUC(-AA AC)GA-G-AU |UAA-UAU-- -UUAG-U(-G -UAA)ACUAA -AUAUUAAA- 961 -AGCCUA<-a uaacaa(aac ---------- ---------- ---------- ---------- 1021 --------)u uguu------ ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> ---------- ---------- ---|-(---) 1321 ---------- ---------- ---------- ---------- ---------- ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--AAGUAAA AUGGAU(--- ---------- 1561 ---ucaa)AU CUGUUUGAAU ----aaAGGG G(AACCU-U) -CCUCUA--A GGCUA-AAUA 1621 ---UA-AUAU A-UAAGCGAU AGUG-AA--- --AAGUACC( -GUGA-)GGU ---AAA-AU- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 --UUG-AAAU AGUA-GUU-U U-<------- ---------- ---------- ---------- 1861 ----->AUAA GCAGCUCAAA U-------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- --aaaauuua aauaaaaa-> (--------- 2041 --)------- AUAAGAGC-G UACCUU(UU- GCAUA)AUGG |GUC-AGCAA GU-----UA- 2101 AUUUUAGAUG CAA--guaaa gauaa--(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ------ccaa u)----uuaa --auua-uaa 2521 aaa-(-guua )--uga<--- ----uuaaaa agguuauuuu aacuuagaua aaccaauuau 2581 ga-------- ---------- ---------- ---------- ---------- ---------- 2641 ------aaaa augag>---- ---------- ---------- ------uuaG UAUCU-AAAA 2701 UUA-GACCCG AA-GGCUA-G UG-AUCUUAC CAU-GGU-CA GGGU------ u--------- 2761 -(-------- ---------- ---------- ---------- ----auaaa) ------a--- 2821 -GCCCGAA-C GG-GUUAUC( GUUGUAU-A) GAUA-UCCGA --AGAAUUG- UGGUAAGUUA 2881 GU(G-AAAG) ACA-AAAC-U G-ACUAGU-- AUAGCU-GGU UUUCC--GCG AA-ACC-UAU 2941 (-AUGA)GUA GG-UA-AUUU AAUU<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->aa CAU|-CUUAG 3061 C|AGGUAC|A GAACUGugau cu-cg----- ---------- ---------< gauaauauc- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- -------(aa uu)------- ---------- ---------- ---------- 3241 gau----uuu aucaacaucg ggggguug-u agugacuuua cugg>----- ---------a 3301 gag-uau-uU GCACUCGG-- AAUG|-GCAA -A-G---AUG ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -aau--GU-U -GAAU-AAUC GGACA--UA- GU-GC(-GAU 3481 AAG)GUUGUA UG-UC----A AAAGGG(AAA -CAG)CCC-A GAACA-A--G AGU-UAA--- 3541 --GGU-UCCA -AAAUUA-U- UGUUGAGUG- --------AA AUUAAGGAU- GUUUAUUAUU 3601 A--------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AUACA-AUCA G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAAAU-A GGC(UUAGAA 3781 GG-G)-GCCA -UUUU|U(U- GA)A|GACCU C(--GUAACA )GA|-GCAC- UGAUUAuAG-UA-A -UA-AAC|-A CCAAAAAU-- ---------- ---------- ----UUAACG 3961 GAUCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ----AAACAA UAU------- ---------- ---------- ---------- 4081 -------|AC CGAA--ACC| U--U-GU|AC Acauau-uau aauaauuaua uaua(uuaau 4141 -----)uaau auauauugu- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- --auaug-UG -G-----GGU AGCGG-AA|- CA-UUGGAUA A---AUA--- 4501 ---------- ---------- (-------)< uuauuuauua uuacuucuaa gauauaauaa 4561 guauaaauau uauuuuaaua auaauaauuu aucaa----- ---------- ---------- 4621 ---------- ------->-- ---------- -|-UAU---| AAUCCAAGAG AGAAUGC-UG 4681 AC|AUGAGUA -ACGA-AAA- AGG------- (aauaa---- ---------- ---------- 4741 ---------- -----)---- --CCU-|CGC C-UUAA-GCU UAUAUGGUAU -|----ug-- 4801 ---------- <--------- --->(----u au)---|--- ---uaa---- ---------- 4861 ---auuuu-- -CGGUGUCUA AAA-A-U--- --auua-(au caaaagg--- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-uaau---- -----U-UUG AU-GAu--a- uuua(uauau guac------ ---------- 5041 ---------- ---------- ----)uaaau |-----|--- ---------- |---- -aaaaaa-ua aaacc----- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 ---- gguuCUGGAA ----AA-Uuu uuu--- ---------- ---------- -ACCGUA|CC 6481 ua-GAUACU- -(AUCACA)A G|UAAGC-AA GUA-(GAG-A A-----)-UA CAAAGGCGU| 6541 |--UUGAG-U G--AACAAUC -AUUA-AGGA ACUCGGCAAA UUGACUACCG UAAC(UUCG- 6601 )GGAUAA-GG AGG|------ ---------- ---------- ---------- ---------- 6781 ----|A(ACA )U--AAAAUA AUGUUGUA|C GA---CUG-U UU(AAUAA)A AA-CACA-GC 6841 ACUCUG|CA- -AAGAU---- ---------- (--uaaau-- ------)--- ---------- 6901 AUCAAAGUA- UUG-AGUGUG AUGUCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CA-AU|G UCGGCA-GGG UAACGA-Auc 7021 u-uccuug-g u-(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- --------au aua)ac--UA AGGUuuUGAA G-GACACC-| 7141 CC-GAUA-AA U-|GG-C|-G -GCCUU-(AU CUAUG)AGGG UC|C(UAA)- GG-UAGCGAA 7201 AUA-CC-U-U |GGCCGU(-U AAAU-)GCGG UC|CU-GCAU GAAUGACAUA A-CGAUACAA 7261 CA-------- ---------- -------GCU GUCUCGAUGA UUGU-CU-CA ----GUGAAA 7321 UU|G|GAAUA GC-AG(U-GC AGAUA)CUGU UUA----CCU CUAGAUAAAC GAGAAG-ACC 7381 CUAUGC-|-A GCUUU--ACU GU|--U-ACC AGU--UGCA| aagu-- ua-----aau uuuaggaUG- UuuucgAGAG 7501 UAUAAGGUA- -GUU------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(---gaaa -)-------- -------GAU 7681 AACAAUGAAA CACCuuu|au ucguuuccu- u---a-uaua ugcu-u---- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->--uu gaAGA-U-UG -GAA-GG-CA GUUUAUGCG( 8161 GGG)CA-CA- G|AUCCCA(- --------CA AAAAGUACA- )UGGGUAU|A |U|CCAA-|< 8221 -aguucauau uguaaauuug uaa-uuuuau uacaaauauu uuaauuuguu auauuuauuu 8281 uuauaaauau acaguua-uu guuaaauuaa guucaauauu uauuuuuauc u--------- 8341 ---------- ---------- ---------- ---------- ---------- ->A-AG-UAA 8401 -GA|--UU-- uuaa-- (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- ----aAA|GU (U|UAAUG)G CUA-AAU-CU 8761 U-GC-UUUAU CGUUU-GAC( -cuacaa--- )GUUCA-UCA G--------- ---------- 8821 ---------- --------UU GC-------- ---(GUAA-- -)-------- ----GCG-GG 8881 G|---CAU-A UGAUC-ACAA GA-U------ ---------- GCA(------ ---------- 8941 ---------- ---------- ---------- ---------- ----UUAAGG AA)AG|GUCU 9001 UGG-AUUAU- |AGA-aAAAG UUACGC|UAG G|GAUAACAG |G-CUA-AuU UGCGCAAGAG 9061 AG(U--ACAA )AUUGAGUGC --GCGGUUUG GC-ACCUCGA UGUC|GG--C U|U|AGCUC| 9121 AU-CC-ACAU GAAUG(--CA -AA)AAUCAU GAAG-GGU|U CGAC(UGUUC )GUCGA-UUA 9181 A--AGAGCU- --ACAUGAGC UGGGUUUAAU AC|GU-C(GU GA)GACAGUA UGGUUUCUAU 9241 CU|UCUAG-A GG|G|<---- ---------- ---------- ---------- ---------- 9301 >AAUUA-AAG UA-GAA-UAA AGA-uaG-CC CCu-(UCGU- AC(-GAAA)G GAGUu)GGGU 9361 a--u--<--- ---------- ---------- -------->A UUGACCU-AU GGUUUACCUA 9421 U|-UGU-UUA ------- 9541 UAG-GCAUGG UAGG--AAGG CUAC-GUCAG UUA------- ---------- -------AAG 9601 ---------- -AUAAGUGCU (GAAAGC--A U-UUA)A-GC -GC-GAAGCU UACUUUA--- 9661 -ggaU--A-- -CUUUAa<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ------(--- )--------- -----aa|CG 9961 UAG(UAGAAC A--)CUACGa guaucauuaa aaaaauauua uuuuuuuuuu uaauguaaUA 10021 G|gcuu-agu ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---uguacuA AUC------- ---------- --------(- ---------- 10141 ---------- -------uua a)GAUUu--- ---------- ---------- ---------- 10201 ----uuagac a|u|aaaugA CUAau-u--- ---------- ---------- ----uauaaa 10261 aaacuaaau- ---------- ---------- ---------- ---aua---- -auauauauc 10321 gaaaa---|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.P.chrys 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Penicillium chrysogenum. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Penicillium chrysogenum. ORGANISM Mitochondria Penicillium chrysogenum. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: S56867,D13859 LOCUS S56867 5360 bp DNA PLN 25-JUN-1993 DEFINITION 1-rRNA...tRNA-Thr {group IA intron} [Penicillium chrysogenum, NRRL1951, Mitochondrial, 3 genes, 5360 nt] ACCESSION S56867 D13859 KEYWORDS . SOURCE Penicillium chrysogenum NRRL1951 ORGANISM Mitochondrion Penicillium chrysogenum Unclassified. REFERENCE 1 (bases 1 to 5360) AUTHORS Naruse,A., Yamamoto,H. and Sekiguchi,J. TITLE Nucleotide sequence of the large mitochondrial rRNA gene of Penicillium chrysogenum. JOURNAL Biochim. Biophys. Acta 1172, 353-356 (1993) STANDARD full automatic COMMENT This entry [NCBI gibbsq 127438] was created by the journal scanning component of NCBI/GenBank at the National Library of Medicine. This sequence comes from Fig. 1. FEATURES Location/Qualifiers rRNA join(143..2977,4656..5236) /note="Description: 1-rRNA" tRNA 5239..5309 /note="Description: tRNA-Thr" CDS 3315..4514 /note="Description: ribosomal protein S5 homolog; For the protein sequence (NCBI gibbsq 127439): Method: conceptual translation supplied by author. This sequence comes from Fig. 1." /codon_start=1 /translation="MLNIIKSKLNTTYKKKGLNDSSIAIYNRDIIPAVRNWKSSIYAY NKNAINLIPIKSKYVMKLIKAYFNLYNLQLESLLRKNRLRRRFRKISTNRIFISDGEF KHTNDKVNITLYVYNKQKLNYLLKLKKRYLTLFKKAKFARKLKLIKNIGLNILCKHKQ KSILLSNLLPKYNTQVNTAQNIYYLRFIKKSFKRLKFYMYYKQMLYINKAKFENTYLQ GLISLVKNIFNKNVEFNIINLKYFYFNSNIFTQPLELKLKKKRNVLRYLKVLIRKAKI KNVKLAEKSKKFFNLNIFNSDNFLQQDNTKSKYLKKIILSDLKYKRVSGVRLEAAGRL TRRFSASRSQRRTKYKGNLENVYSSFKGYPTPMLRGNDKANLQYTVINSTSRVGAFGV KGWVSST" BASE COUNT 2136 a 582 c 799 g 1843 t ORIGIN BASE COUNT 1354 a 424 c 603 g 1177 t 7217 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ caaauuaaau 61 uaauguaaau acauuauagg uuuuacaggu uaguguccgg ugguuggucg cuucauuugg 121 guuggagauu guuuauguuc gaaucauaau aaccugauaa uuaauauagg uauaauuaua 181 uauaccaaua ua>gauga-u auguau---- --cauaua-- --ca-ucuug a--------- 241 ----gaaa-- ---------- -ucaagacaa guauaUAAAG AAACUAUUA- ----UGGAUG 301 |GUU--AGC| UAU-AUAU-U U|caagaua- ---------- ----uugau| -cuag(aaaa 361 auauaaa--) c|uagaaau- cauagag-aa a-ucuaauua ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ----uaAGAC |AAAGUGAAU 841 UGA(AAUA)U CUUAGUA--- -ACUUU---- ---------- ---------- ---AGUAAAA 901 GAAAUC(-AA AC)GA-G-AU |UGU-UAU-- -UUGG-U(-G -UCU)UCUGA -AUAGCAAA- 961 -AGCCUU------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> ---------- ---------- ---|-(---) 1321 ---------- ---------- ---------- ---------- ---------- ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--AAGUAUA ACGGAA(--- ---------- 1561 ---aaaa)AU CUGUUGAAAA ----auAGGG G(AACCU-U) -CCUCUA--A GGCUA-AAAA 1621 ---AA-AUAU A-UAAGCGAU AGAG-UA--- -ACAGUACC( -GAGA-)GGG ---AAAUAC- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 -cCUG-AAAU AGUA-GUU-U U-<------- ---------- ---------- ---------- 1861 ----->AUAA GCAGCUCAAG Uua-----<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---aaauuua aauaaa---> (--------- 2041 --)-----ua AUAAGAGC-G UACCUU(UU- GCAUA)AUGG |GUC-AGCAA GU-----UA- 2101 AUUUUAGAUG CAA--guaa- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---caucucu uuuauaagca u)-------- ---uua-c-- 2521 ----(----- )-----uuau g-(aaaa--) -a-auga--- -----auuaG UAUCU-AGAA 2701 UUA-GACCCG AA-GGCUA-G UG-AUCUUAC CAU-GGU-CA GGGU------ u--------- 2761 -(-------- ---------- ---------- ---------- ----auaaa) ------a--- 2821 -GCCCGAA-C GG-GUUAUC( GUUGUAA-A) GAUA-UCCGA --UGAACUG- UGGUAAGUUA 2881 GU(G-AAAG) ACA-AAAC-U G-ACUAGU-- AUAGCU-GGU UUUCC--GCG AA-ACC-UAU 2941 (-GUAA)GUA GG-UA-AUUU AAUU<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->aa CAU|-CUUAG 3061 C|AGGUAC|A GAACUGugau cu-cg----- ---------- ---------< gacaa-uau- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- --------uu aau------- ---------- ---------- ---------- 3241 aua----uuu gucaacaucg ggggguug-u agugacuuua ccgg>----- ---------a 3301 gag-uau-uU GCACUCGG-- AAGG|-GCAA -A-G---AUG ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -aau--GU-U -AAAU-AAUC GGACA--UA- GU-GC(-GAU 3481 AAG)GUUGUA UG-UC----U AAAGGG(AAA -CAG)CCC-A GAACA-A--G AGU-UAA--- 3541 --GGU-UCCA -AAAUUA-U- UGUUAAGUG- --------AA AUUAAGGAU- GUUUUUUUUU 3601 A--------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AAACA-AUCA G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAAAU-A GGC(UUAGAA 3781 GC-G)-GCCA -UUUU|U(U- GA)A|GACCU C(--GUAACA )GA|-GCAC- UGAUUAuAG-GA-A -AA-AAC|-G CCGAAAAU-- ---------- ---------- ----UUAACG 3961 GAUCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ----AAAUAA UAU------- ---------- ---------- ---------- 4081 -------|AC CGAA--ACC| U--U-GU|AC Acaaa--uaa aa---auuaa a-gc(guuau 4141 a----)gcuu ---------a aua------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- --uuuug-UG -G-----GGU AGCGG-AA|- CA-UUGGAUU A---AAC--- 4501 ---------- ---------- (-------)< --aaaauauu aauauuuuuc uuaaaauauu 4561 aaagaucuag caucu----- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- -|-GUU--a| AAUCCAAGAG AGAAUGC-UG 4681 AC|AUGAGUA -ACGA-AAA- AGG-CU---- (uuu------ ---------- ---------- 4741 ---------- -----)---- AGCCU-|CGC C-UGAA-GCU UAU--GGUU- -|-------- 4801 ---------- (----- --)---|--- ---------- ---------- 4861 ---------- -CGGUGUCUA AAA-A-A--- --auua-(au caaaaga--- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-uaau---- -----U-UUG AU-GAc--g- uuuu(guau( aagaua)aua cc-------- 5041 ---------- ---------- ----)aaaac |-----|--- ---------- |---- -uauua--ua auaua----- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 ---- uauacuggaa ----aa--ua aua<------ 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- -aaua----- ---------- -ACCGUA|CC 6481 ua-GAAACU- -(AACUCA)A G|UAAGC-AA GUA-(GAG-A A-----)-UA CAAAGGCGU| 6541 |--UUGAG-A G--AACAAUC -AUUA-AGGA ACUCGGCAAA UUGACU-CUG UACC(UUUG- 6601 )GAAUAA-GG AGG|------ ---------- ---------- ---------- ---------- 6781 ----|A(UCA )U--GAAAUA AUGUUGUA|C GA---CUG-U UU(AAUAA)A AA-CACA-GC 6841 ACUCUG|CA- -AAGAU---- ---------- (--aaaaa-- ------)--- ---------- 6901 AUCAAAGUA- UUG-AGUGUG AUGUCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CA-AU|G UCGGCU-GGG UAACGG-Auc 7021 u-ACCUUg-a u-(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- --------ua uua)ac--UG AGGUuuUGAA G-GACACC-| 7141 CC-GAUU-AA U-|GG-C|-G -GCCUU-(AC CUAUG)AGGG UC|C(UAA)- GG-UAGCGAA 7201 AUA-CC-U-U |GGCCGU(-U AAAU-)GCGG UC|CU-GCAU GAAUGAUUUA A-CGAUGCAA 7261 CA-------- ---------- -------GCU GUCUCGAUGA UUGU-CU-CA ----GUGAAA 7321 UU|G|GAAUA GC-AG(U-GC AGAUA)CUGU UUA----CCU CUAGAUAGAC GAGAAG-ACC 7381 CUAUGC-|-A GCUUU--ACU GU|--U-ACU AAU--UAUA| gagu-- ga-----aau uuuaggaUG- auuuauAGUG 7501 UAUAAGGUA- -GUU------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(---guug a)-------- -------GAU 7681 AAUAAUGAAA CACCuuu|au ucgaauccu- u---a-uaua uacu-c---- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->--uu aaUGA-U-UA -GAA-GG-CA GUUUAUGCG( 8161 GGG)CA-CA- G|AUCCCA(- --------CA AAAAGUACC- )UGGGUAU|A |U|CCAA-|< 8221 -aguucauau uguaaacuug uauauuuaua uacaaauauu uuaauuuguu cuaauuauua 8281 uuauaauuau acaguuauua uucgauuaaa uuccacaauu auuuuuuauu uu-------- 8341 ---------- ---------- ---------- ---------- ---------- ->A-AG-UAA 8401 -GA|--UU-- uuaa-- (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- ----aAA|GU (U|UAAUG)G CUA-AAU-CU 8761 U-GC-UUUAC UGUUU-GAC( -cuacaa--- )GUCUA-UCA G--------- ---------- 8821 ---------- --------UC GC-------- ---(GUAA-- -)-------- ----GCG-GG 8881 G|---CAU-A UGAUC-ACAA GA-U------ ---------- GCA(------ ---------- 8941 ---------- ---------- ---------- ---------- ----UUAAGG AA)AG|GUCU 9001 UGG-AUUAU- |AGA-AAAAG UUACGC|UAG G|GAUAACAG |G-CUA-AuU UGCGCAAGAG 9061 AG(U--ACAA )AUUGAGUGC --GCGGUUUG GC-ACCUCGA UGUC|GG--C U|U|AGCUC| 9121 AU-CC-UCAU GCAUG(--CA -GA)AAUCAU GAAG-GGU|U CGAC(UGUUC )GUCGA-UUA 9181 A--AGAGCU- --ACAUGAGC UGGGUUUAAU AC|GU-C(GU GA)GACAGUA UGGUUUCUAU 9241 CU|UCUAG-A GG|A|<---- ---------- ---------- ---------- ---------- 9301 >ACAUA-AAG UA-GAU-UAA AGA-UAG-CC CCu-(UCGU- AC(-GAAA)G GAGUu)GGGU 9361 a--u--<--- ---------- ---------- -------->A UUGAUCU-CU GGUUUACCUG 9421 U|-UGU-UUA ------- 9541 UAG-GCAUGG CAGG--AAAG CUAC-AUCAG UUA------- ---------- -------AAG 9601 ---------- -AUAAGUGUU (GAAAGC--A U-CUA)A-AC -GC-GAAGCA AACUUUA--- 9661 -UGAU--A-- -CUUUUa<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ------(--- )--------- -----ua|CG 9961 UAG(UAGAAC A--)CUACGa gcauaauugu -------uua auu------a caauu-aaUA 10021 G|GCUUUagu ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---uguaagA AUG------- ---------- --------(- ---------- 10141 ---------- -------aua a)CAUUu--- ---------- ---------- ---------- 10201 ----uuagau a|u|AAAGUA CUAau-u--- ---------- ---------- ----uaaaaa 10261 aaaaaguaua cuaaauauua uuuaauauca uuauaauauu uuuu------ -uuauauauu 10321 acaaua--|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.N.crass 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Neurospora crassa. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Neurospora crassa. ORGANISM Mitochondria Neurospora crassa. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: X55443 Neurospora crassa mitochondrial LSU rRNA >From Helmut Bertrand Nucleic Acids Research "For the Record", in press; X55443 BASE COUNT 1216 a 499 c 684 g 1066 t 7310 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~aaa-u guaauggaua uaaagcuuau guuuauauau ---------- 241 ---auagac- ---------- --auauauaa guauaUAAAG AGACUACUA- ----CCAAUA 301 |GCU-acAC| UAU-GUAU-U A|aggaga-- ---------- -------gu| -auaa(-cuu 361 aau------) u|uauguuu- augauuu|ua u-cauacccc uaaaaaugac accgaggagc 421 a--------- ---------a gggucgg-gu uagcauc-cu gguucguaca c(cuug)gug 481 accuaggcua guaccag-gu cccccucuaa ggga(cuug) ucccccucua agggac-uug 541 cgucgguccu a(ucc)uagg ccg- --uaauAAAC |GAAGUGAAU 841 UGA(AAUA)U CUUAUUA--- -ACUUC---- ---------- ---------- ---AGGAAAA 901 GAAAUC(-AA AC)GA-G-AU |UCU-AUGA- -UUAG-U(-G -UGA)ACGAA -AAUAGAGC- 961 -AGCCUA<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> ---------- ---------- ---|-(---) 1321 ---------- ---------- ---------- ---------- ---------- --<-uuaaaa 1381 u--------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- ---AAGUAAA AUGGCU(--- ---------- 1561 ---uuaa)AG CUGUUUGAAU --auugUGGG G(AACCU-U) -CCUCAA--A GGCUA-AAUA 1621 ---UA-AUAC A-UGAGUUAC AGAG-AA--- --AAGUACC( -GUGA-)GGG ---AAA-GC- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 -uUUG-AAAU AGUA-GUU-U U-<------- ---------- ---------- ---------- 1861 ----->AUAA GCAGCUCAAG C-------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (aauaagaaa 2041 --)------- GCGAGAGC-G UACCUU(UU- GCAUA)AUGG |GUC-ACCAA GU-----UA- 2101 AUUUUAGAUG CGA--gcgaa u-uuauu(ua u--------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------g 2341 uuuuuacuga uuaaacaaua uaaugaauca uaauuauuuu uguaacgagu auuaguauua 2401 aaucuuaauu uaauauuagu auaaguuuuc aguauggagg auacauagca uaaucuaugc 2461 agccagccaa uaauuggauu uccaauccaa uuucgguaau a)--aauaga --ugug-cau 2521 agu-(-uaaa )--ccgucau ua(-aaa--) ua-auga--- ------auaG UGUCU-AAAG 2701 UUA-GACCCG AA-GCCUG-G UG-AUCUUAC UAU-AGU-CA GGAC------ u--------- 2761 -(-------- ---------- ---------- ---------- ----auaaa) ------g--- 2821 -GUCCGAA-C GG-GUUAUC( GUUGCAA-A) GAUA-UCCGA --AGAACUA- UGGUAAGCGA 2881 GU(G-AAAG) ACA-ACAC-U G-ACUAGG-- AUAGCU-GGU UUUCU--GCG AA-ACC-UAU 2941 (-AAUA)GUA GG-CA-AUUU AAGU<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->aa CAU|-CUUAG 3061 U|AGGUAC|A GAACUua-AU CU-ca----- ---------- ---------< gacaa-gaug 3121 uaga-----u uuucauaccu a--------- ---------- ---------- ---------- 3181 ---------- -------(ug uu)------- ---------- ------uagg uaugaaaugc 3241 auuuuuuuuu guauacaucg ggggaucg-u gaagauuuua ucgg>----- ---------u 3301 gAG-uAu-gu AGACUCGG-- AAUG|-ACAA -A-G---AUG ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -aau--CU-U -GAAU-AAUC AGACA--UA- GA-AU(-GAU 3481 AAG)GUUGUA UG-UC----A AAAGGG(AAA -CAG)CCC-A GAACA-A--G AGU-UAA--- 3541 --GGU-UCCA -AAAUUA-U- UAUUAAGUG- --------AA AUAAAGAAA- GUUUUUAUAU 3601 A--------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AGUCG-ACAA G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->AAGAU-G GGC(UUGGAA 3781 GC-A)-GCCA -UAAU|U(U- AA)A|GAUCU C(--GUAACA )GA|-GCAC- UUGUUAAUC-UU-A -AA-AGC|-A UCGAAAAU-- ---------- ---------- ----UUAACG 3961 GAUCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ----AAAUAA UAU------- ---------- ---------- ---------- 4081 -------|AC CGAA--ACC| U--U-GU|CC Au-------- auguaacauu agua(auaau 4141 augc)uauua auguuauuug ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ------a-UG -G-----GGU AGCAG-AA|- CG-UUGAGUG A---AUCuua 4501 g--------A UuUUU-uuUU (uau----)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->AA cuA--AAu-A U|AGAUGAU| AACUCAAGUG AGAAUGG-UG 4681 AC|AUGAGUA -ACAA-AAA- AGAGUU-UA- (agguaccu- ---------- --(aaa)--- 4741 ------aggu aucuu)-A-G AGUCU-|CGC C-UAAA-GCU UAU--GGCU- -|----ac-- 4801 ---------- ---------- ----(--guc aa)---|--- ---gua---- ---------- 4861 ---a------ -CGGCCUCUA A-GUU-U--- AUAAUC-(ug aa-------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-GAUU---A U----G-ACG AU-GAGAAa- auaa(cgcgc (agaa)gugc g--------- 5041 ---------- ---------- ----)cugcu |-----|uug a--uacuu-- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ -------aa- ugacaa---- -ACCGUA|CC 6481 UA-GAAUCU- -(GAAACA)A G|UAAGC-UA GUA-(GAG-A A-----)-UA CGAAGGCGU| 6541 |gaAUGAG-A U--AACAAUC -AUAA-AGGA ACUCGGCAAA CUAACUACCG UAAC(UUAG- 6601 )GGAUAA-GG AGA|gcucau uagucucg-- -----(auua aua)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->----cg aguaaaaagg 6781 aaga|A(GCA )U--GGAAUA UUGUUGUA|C GA---CUG-U UU(AAUUA)A AA-CAAA-GC 6841 ACUUUG|CAa aAAGAC---- ---------- (--gauaa-- ------)--- ---------- 6901 GUCUAAGUA- UUG-AGUGUG AUUUCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-AU|G CCGGCU-GGU UAACGA-Auu 7021 u-ucuaaa-u u-(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ------gaaa aaa)aa--uu ugguuucaGA G-GAACCC-| 7141 CC-GGUU-AA U-|GG-C|-G -GCCUU-(AG C-GUG)AGGG UC|C(UAA)- GG-UAGCGAA 7201 AUG-CC-U-U |GGCCGU(-U AAAU-)GCGG UC|UU-GCAU GAAUGAUGUA A-CGAUACAA 7261 CA-------- ---------- -------GCU GUCUCUAUGA UUGA-CU-CA ----GUGAAA 7321 UU|G|GAAUA AC-UG(U-GC AGAUA)CAGU UUA----CCU CUAGUUAGAC GAGAAG-ACC 7381 CUAUGC-|-A GCUUU--ACU GU|--U-ACU AAU--UAUU| aauac- ga-----uuc -ugaaaauu- ucc---AGUG 7501 UAAAAGGUA- -AUC------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(---gaua a)-------- -------GAU 7681 AUAAUUGAAA CACCUUU|a- ----uuuuu- c-u----auc guau-uauua aacc-uu--- 7741 a----(---a au--)----u ---------- ---------- ---------- ---aagg-<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->-AAC AAUUG-U-UA -GAA-GA-CA GUUUAUGCG( 8161 GGG)CA-CA- G|GCCCCA(- --------UA AAGAGUAAA- )UGGGUGU|G |U|CUAA-|< 8221 aauuuauaaa uuuauguuug caauuuuuua uagugauuau auaucaaauc aucuuuaugc 8281 uauucauaga guguauuuau uauauuccuu ggguacagua uaaaaauuau auauguauua 8341 auuuacauau auuuuuucua agaaauu--- ---------- ---------- ->A-GG-UAA 8401 -GA|--UUu- ------ (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- ----aAA|GC (U|UAAUG)G CUU-AAU-CU 8761 U-GC-CUUAC UGUUU-GAU( -uaacaacaa )AUCUU-ACA G--------- ---------- 8821 ---------- --------UC GC-------- ---(GUAA-- -)-------- ----GCG--G 8881 G|---CAU-A GGAUC-ACAA GA-U------ ---------- ACA(------ ---------- 8941 ---------- ---------- ---------- ---------- ----AAAAGG AA)AG|AUCU 9001 UGGauuuuu- |gg--aAAAG CUACGC|UAG G|GAUAACAG |G-CUA-AuU UGCGCAAGAG 9061 UG(U--ACAA )AAUGAGUGC --GCGGUUUG GC-ACCUCGA UGUC|GG--C U|U|GACUA| 9121 AU-CC-UCAU GGAUG(--CA -GA)AACUAU GUAG-GGU|A CGAC(UGUUC )GUCGA-UUA 9181 A--AAAGUU- --ACAUGAGC UGGGUUAAAU AG|CU-C(GU GA)GACAGUA UGGUUUCUAU 9241 CU|UCUAG-A GG|G|<---- ---------- ---------- ---------- ---------- 9301 >AAUUA-GAA UA-UAA-UAA GGA-uua-ac cu--(UUGU- AC(-GAAA)G GAACa)uggg 9361 g--ua-A UUAACCU-CU GGUUUACCUG 9421 U|-UGU-UUA ------- 9541 UAA-GCAUGG CACC--AAAG CUAA-GUUAG UCA------- ---------- -------AAA 9601 ---------- -AUAAGUGCU (GAAAGC--A U-AUA)G-GC -AC-GAAAUU UACCUUA--- 9661 -AGAU--A-- UUUCUU-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- ---------- aaauaua|CG 9961 UAA(GAAAAU A--)UUACGU U--------- ---------- ---------- ------aaUA 10021 G|GCuuaguu ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---uguaaua auc------- ---------- --------(- ---------- 10141 ---------- -------uag a)gauuu--- ---------- ---------- ---------- 10201 ----uaagga a|c|uaaGUA CUAau-u--- ---------- ---------- ----u-uaua 10261 -aaaaacuga au-------- ---------- ---------g auuaauauau c--uuacauu 10321 uuc-----|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.P.anser 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Podspora anserina. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Podspora anserina. ORGANISM Mitochondria Podspora anserina. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: X14735,X55026 LOCUS X14735 9377 bp UNA 15-MAR-1990 DEFINITION Podospora anserina mtDNA for large subunit rRNA. ACCESSION X14735 REFERENCE 1 (bases 1 to 9377) AUTHORS Cummings,D.J., Domenico,J.M. and Nelson,J. TITLE DNA sequence and secondary structures of the large subunit rRNA coding regions and its two class I itrons of mitochondrial DNA from Podospora anserina JOURNAL J. Mol. Evol. 28, 242-255 (1989) STANDARD unannotated staff_entry BASE COUNT 3391 a 1300 c 1707 g 2979 t ORIGIN BASE COUNT 1450 a 613 c 817 g 1266 t 6629 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~uua-u aaaa------ -auauaaaug aauug-uaua uaucuu---- 241 -uuauauuau aucu---aag -auaua-caa guauaUAAAG AGACUAUUA- ----UGGAAA 301 |UAC-guGC| UAU-GUAU-U A|aagaga-- ---------g aaauuuaac| -uuau(guac 361 auga-----) a|uaaaaca- u---aug--- ---------- ---------- ---------- 421 ---------- ---------- ---------- -----aa-cu c--------- -----(-uua 481 )gag|----- ---------- ---------- --aaa----- ---------- -(--uu-a)- 541 ---------- -----uuuaa u--<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- ------AAAC |GAAGUGAAU 841 UGA(AAUA)U CUUAUUA--- -ACUUC---- ---------- ---------- ---AGGAAAA 901 AAAAUC(-AA AC)GA-G-AU |UCU-AUGA- -UUAG-U(-G -UGA)ACUAA -AAUAGAGU- 961 -AGCCUA------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> ---------- ---------- ---|-(---) 1321 ---------- ---------- ---------- ---------- ---------- --<-ua---- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >---AGUAAA AUGGCC(--- ---------- 1561 ---uaaa)AG CUGUUUGAAU ---uuaUGGG G(AACCU-U) -CCUCAA--A GCCUA-AAUA 1621 ---UA-AUAC A-UGAGCGAC AGUG-AA--- --AAGUACC( -GUGA-)GGG ---AAAauu- 1681 uu-------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 -uUUG-AAAU AGUA-GUU-U U-<------- ---------- ---------- ---------- 1861 ----->AUAA GCAGCUCAAG Cugau---<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (-----aaua 2041 --)---aaaa GCAAGAGC-G UACCUU(UU- GCAUA)AUGG |GUC-ACCAA GU-----UA- 2101 ACAUUAGAUG CGA--gcuaa u-uaucu(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- --ugauuuga u)--agauga --caug-cau 2521 agu-(-uaaa )--ccgucau ua(-aaa--) ua-auga--- ------auaG UGUCU-AAAG 2701 UUA-GACCCG AA-GCCUA-G UG-AUCUUAC UAU-AGU-CA GGGC------ u--------- 2761 -(-------- ---------- ---------- ---------- ----auaaa) ------g--- 2821 -GUCCGAA-C GG-GUUAUC( GUUGCAA-A) GAUA-UCCGA --AGAACUA- UGGUAAGCGA 2881 GU(G-AAAG) ACA-ACAC-U G-ACUAGG-- AUAGCU-GGU UUUCU--GCG AA-ACC-UAU 2941 (-AAAA)GUA GG-CA-GUUU AAGU<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->aa CAU|-CUUAG 3061 C|AGGUAC|A GAACUuu-AU CU-ca----- ---------- ---------< gacaa-gaug 3121 uaua-----u ucucauaugg auaagua--- ---------- ---------- ---------- 3181 ----aggcgc ggcgcggc(g aaa)gcucuu ccucgcuauu uaucuauuua uaugaaauac 3241 auu-uuauuu guauacaucg ggggaucg-u gaagauuuua ucgg>----- ---------u 3301 gAG-uAu-gu AGACUCGG-- AAUG|-ACAA -A-G---AUG ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -guu--CU-U -GAAU-UAUC GGACA--UA- GA-AU(-GCU 3481 AAG)GUUGUA UG-UC----A AAAGGG(AAA -CAG)CCC-A GAACA-A--A -GAaauaguu 3541 aaGGU-UCCA -AAAUUA-U- UAUUAAGUG- --------AA AUUAAGAGG- GUUUUUAUAU 3601 A--------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AGUCG-ACAA G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->AAGAU-A GGC(CUGGAA 3781 GC-A)-GCCA -UAUU|U(U- AA)A|GACCU C(--GUAACA )GA|-GCAC- UUGUUAAUC-UU-A -AA-AGC|-A UCGAAAAU-- ---------- ---------- ----UUAUCG 3961 GAUCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ----AAAUAA UAU------- ---------- ---------- ---------- 4081 -------|AC CGAA--ACU| U--U-GU|CC Acaa------ ---augacca uaau(aaauu 4141 a--a)guuau ggucauuu-- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ----uug-UG -G-----GGU AGCAG-AA|- CG-UUGAGUU A---AUAuuu 4501 g--------A CUUUU-CUUU (uuu----)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->AA AGA--AAA-A U|AUAGGAC| AACUCAAGUG AUAAUGG-UG 4681 AC|AUGAGUA -ACAA-AAA- AGAAGG-GC- (uauguaaau uauaauauaa ua(uaa)uau 4741 uauauuauau guuaa)-G-C UCUCU-|CGC C-UAAA-GCU UAU--GGAA- -|----ag-- 4801 ---------- ---------- ----(--agu u-)---|--- ---uua---- ---------- 4861 -aaaaaguaa -CGGCCUCUA A-GUU-G--- AUAAUA-(cu ua-------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-UAUU---A U----U-GCG AU-GAGAAa- aucu(aauua cuuu------ ---------- 5041 ---------- ---------- ----)agaca |---ac|auu uaaccuu--- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ --------aa ggaagu---- -ACCGUA|CC 6481 UA-GAAACU- -(GAAACA)A G|UAAGC-UA GUA-(GAG-A A-----)-UA CGAAGGCGU| 6541 |-aAUGAG-G U--AACAAUC -AUAA-AGGA ACUCGGCAAA CUUACUACCG UAAC(UUAG- 6601 )GGAUAA-GG AGG|gcucau uagucucg-- -----(auua aua)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->----cg aguaaaaagg 6781 aaga|A(GCA )U--GAAAUA UUGUUGUA|C GA---CUG-U UU(AAUUA)A AA-CAAA-GC 6841 ACUUUG|CAu aAAGAU---- ---------- (--GAAA--- ------)--- ---------- 6901 AUCUAGGUA- UUG-AGUGUG AUCUCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-AU|G CCGGCU-GGU UAACGA-Auu 7021 a-acuaua-u u-(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- -------gau aaa)ag--ua uggucuuaGA G-GAACCC-| 7141 CC-GGUU-AA U-|GG-C|-G -GCCUU-(AG C-GUG)AGGG UC|C(UAA)- GG-UAGCGAA 7201 ACG-CC-U-U |GGCCGU(-U AAAU-)GCGG UC|UU-GCAU GAAUGAUGUA A-CGAUACAA 7261 CA-------- ---------- -------GCU GUCUCUAUGA UUGA-CU-CA ----GUGAAA 7321 UU|G|GAAUA GC-AG(U-GC AGAUA)CUGC UUA----CCU CUAGUUAGAC GAGAAG-ACC 7381 CUAUGC-|-A GCUUU--ACU GU|--U-ACU AAU--UAUU| aauau- ga-----ucc -cggcuauu- cug---AGUG 7501 UAUAAGGUA- -AUU------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(---gaua a)-------- -------AAU 7681 AUAAUUGAAA CACCUUu|a- ----uuauu- c-c----auc auau-uauaa u--------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------GAAC AAUUG-U-UA -GGA-GA-CA GUUUAUGCG( 8161 GGG)CA-CA- G|ACCCCA(- --------UA AAGAGUAAA- )UGGGUGU|G |U|CUAA-|< 8221 -uaauaaaaa aauuuauguu ugcaauuuuu uauaguaauc cuauauuuaa ucauguaugu 8281 ucuauucaua gaauauaaua ugaaugaauu cgauucauuu auaauauagu ccuuggguac 8341 aguauaaaaa uuauauaugu auuuuugcaa uauaauuucc augaaauuag g>A-GG-UAA 8401 -GA|--UU-- uu---- (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- ----aAA|GC (U|UAAUG)G CUU-AAU-CU 8761 U-GC-CUUAC UGUUU-GAU( -uaacaacaa )AUCUU-ACA G--------- ---------- 8821 ---------- --------UC GC-------- ---(GUAA-- -)-------- ----GCG-GG 8881 G|---CAU-A GGAUC-ACAA GA-U------ ---------- ACA(------ ---------- 8941 ---------- ---------- ---------- ---------- ----AAAAGG AG)AG|AUCU 9001 UGGauuauu- |gg--aAAAG CUACGC|UAG G|GAUAACAG |G-CUA-AuU UGCGCAAGAG 9061 UG(U--ACAU )AAUGAGUGC --GCGGUUUG GC-ACCUCGA UGUC|GG--C U|U|AACUU| 9121 AU-CC-UCAC GGAUG(--CA -GA)AACUAU GUAG-GGU|A CGAC(UGUUC )GUCGA-UUA 9181 A--AAAGUU- --ACAUGAGC UGGGUUAAAU AC|GU-C(GU GA)GACAGUA UGGUUUCUAU 9241 CU|UCUAG-A GG|G|<---- ---------- ---------- ---------- ---------- 9301 >AAUUA-GAA UA-UAA-CAA GGA-uua-au cu--(-UGU- AC(-GAAA)G GAACa)uggg 9361 g--ua-A UUAACCU-CU GGUUUACCUG 9421 U|-UGU-UUA ------- 9541 UAA-GCAUGG CAGG--AAAG CUAA-GUUAG UCA------- ---------- -------AAG 9601 ---------- -AUAAGUGCU (GAAAGC--A U-AUA)G-GC -AC-GAAGCU UGUCUUG--- 9661 -GGAU--A-- UUUCUU-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- ---------- aaauaua|CG 9961 UAA(UAUAAU A--)UUACGU C--------- ---------- ---------- ------auUA 10021 G|GCuuaauu ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---ugcaaga auc------- ---------- --------(- ---------- 10141 ---------- -------uag a)gauuu--- ---------- ---------- ---------- 10201 ----uaaggu a|u|uaaGUA CUAau-u--- ---------- ---------- ----u-uaua 10261 gu-------- ---------- ---------- ---------- ---aaa---- ---cuauaua 10321 auug----|- -------aua uauuuuauuu aaagccgagu uagcauaaaa ggaaugcaau 10381 uguuuuguaa ucaauagaag uaagugcgau acuugcaccc ggcuaggagu uauaaggauu 10441 aguagucaag ugguacgaca uagcucuuuc aaugcuacca ucgcagguuc gauuccugcc 10501 uagucuauua gguaggcgca agccacauac auaauggcga aguauaucga ggagcuugcg 10561 cuauauauac agcagacgaa uuauaaauau cccuacguca ggcgcagagg uuuacauacg 10621 acgaguuaua uauauaaccc uacguaugua ugcccagcac cgucauucuu uuuauugagg 10681 cuauagcuca auugguagag cguacugcuc auaacaguaa uuauaagugu ucaagucacu 10741 uuagccuuau ggcuguauau ucugcugcag ||||| // LOCUS mt.P.canad 10775 bp RNA RNA 09-JAN-1995 DEFINITION Mitochondria Pichia canadensis. str. was Hansenula wingei. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Pichia canadensis. str. was Hansenula wingei. ORGANISM Mitochondria Pichia canadensis. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: D31785 BASE COUNT 1383 a 246 c 374 g 1082 t 7690 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~auaaa aaauauaaga 181 auauaaauau aaaaauaa-a auguauagau u--------- ---------- ---ugaaaag 241 uguuauacgg cau------- ---------- -----UAAAG GGUUAUUCA- ----AGGAAU 301 |AUA-uuAC| UAU-UAAU-A A|ggaa---- ---------- -----aggu| ---------- 361 ---------- -|-------- ---------- ----uacuaa uaauuaaaua auauuuaauu 421 uaaa------ ---------- ---------- accuaa---g g--------- -----(uaaa 481 )cc-|----- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- --auag-->- --aaaaAAAC |GUGAAGAAC 841 UGA(AUCA)U CUAAGUA--- -UUCAU---- ---------- ---------- ---AGGAAAA 901 GAAAUC(-AA AA)GA-G-AU |AUU-AUGA- -GUAA-U(uG GCGA)AUGAA -AAUAAUAA- 961 -AGUUAA------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> ---------- ---------- ---|-(---) 1321 ---------- ---------- ---------- ---------- ---------- ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- ---AAGUAAU CCCU--(--- ---------- 1561 ---uuag)-- GGGGAUGAAU ----aaAGAU U(AAACU-A) -AAUCUA--A AACUA-AAUA 1621 ---UU-AUUA A-UAAGUAUA aa-------- --AAGUACC( -GAAA-)GGG ---AAA-AU- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 --AUAGAAAU GGAU-AAU-U U-<------- ---------- ---------- ---------- 1861 ----->AUAA GCAGUAUgag acuuu---<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (------aaa 2041 --)---aaag uuuaAUAC-G UACCUU(UU- GUAUA)AUGG |GCC-AGCAA GU-----AA- 2101 UAAUAAUUAG CAA--aauau u------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- --------aa a)-------- a-auau-uaa 2521 aua-(-uaaa )--uagaa gau|uauuau 3061 a|UGGUAU|A GCAAuua-au au-uu----- ---------- ------aa-< auuua-uuau 3121 uauu-----u au-------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ------aaua auaaau---- 3241 ---------- -------aug gggguc-aau uauagacuua ucau>----- ---------g 3301 uau--au-uu aauCUCAU-- AAUA|auaua -a-u---auc auuauuaauu aauaaaauaa 3361 uuaaua---- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -aaaaaAU-U -AACU-AAUC AGACU--GU- AU-GC(-GAU 3481 AAG)GUAUAU AG-UC----G AGAGGG(AAA -CAG)CCC-U AAAUA-a-AA -UA-UAA--- 3541 --GGU-UCUA -AAAUAU-A- AAUUAAGUG- --------aa uaaaaugua- uaauaaauuc 3601 -au------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AAUCA-AUUA G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->uuGGU-G GGU(UUGACA 3781 AU-A)-ACUA -UCCU|A(U- AA)U|GAACA U(--GUAACA )AU|-GCAC- UAAUaaaga-aa-u -uu-uau|-a cagauaa--- ---------- ---------- ----UACACG 3961 GAUCU----- ---------- ---------- ---------- uaaaaauaua uuuuuuuaau 4021 uaaagauaua uuauaAAUUU AUU------- ---------- ---------- ---------- 4081 -------|AC CGAA--GAU| U--U-AU|AU Auuuauauau ---------- ----a-uaaa 4141 aaca-a---- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 --------au auauaaa-UA -U-----AGU AACAG-AG|- CA-UAUAAUA A---auaaaa 4501 uauaaua--- -guua-gaua (-------)< aauuauuaua aaaauuaaau aaaaauaa-- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->ua uuu--aau-a a|auau--u| aAUUAUAUUG AGAAUGC-UG 4681 GC|AUGAGUA -GCGA-AAA- AUA-AG-Ua- (auaaaaauu auaa------ ---------- 4741 ---------- -----)---A CUUAUu|CAC A-uaau-ACA UAA--gguu- -|----uua- 4801 ---------- ---------- ----(---cu a-)---|--- --uaaa---- ---------- 4861 ---uu----- -CGGUCCUUA A-AUU-A--- guauau-(aa auaua----- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >auaua---- -----u-auG AU-AGGuu-- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- -ACCGUA|AU 6481 U--AAUACC- -(GACCCA)G G|UGUGUAUA GUA-(GAG-A A-----)-UA UGAAaGUGA| 6541 |--AUGGA-A A--AAAUAUG -GUUA-AGGA ACUCGGCAAA AACAAC-CCC CACG(UUAGU 6601 )CAAAAAAGG GUA|------ ---------- -----(---- ---)------ ---------- 6781 ----|-(--- )---agaaUA AGAUUAUA|C AA---CUG-U UU(ACUAA)A AA-CACA-GC 6841 ACUUUG|CA- -GAUAU---- ---------- (--aaaa--- ------)--- ---------- 6901 AUAUUAGUA- UAA-GGUGUG AAUCCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CU-CA-AU|G AUUUA--aua acuaaa-aa- 7021 --uuauuu-u u-(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- -------aua aaa)gg--aa auaa--uu-c u-aaagau-| 7141 UA-GUCA-AA U-|AG-C|-A -GCCUU-(AU -UUUG)AGGG UU|A(UAA)- UG-UAGCGAA 7201 AUU-CA-U-U |GGCUAC(-U AAUU-)AUAG UC|CU-GCAU GAAUGGAGUA A-UGAUAUAA 7261 UA-------- ---------- -------ACU GUCUCAACCA UAUA-UC-CA ----GCGAAA 7321 UU|G|GAUUA GC-AG(U-GA AGAUA)CUGC UAA----ACU UCAGUAAGAC GGAAAG-ACC 7381 CUAUGC-|-A GCUUU--ACU AU|--u-aau aaacaaacu| <--------- ---------- 7441 ---------- ---------- --->guuuu- au-----auu -uauauuua- uuc---AGCU 7501 UAUAAAGUA- -AUA------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(--aauag u)-------- -------UAU 7681 AAAAUUGAGA AACUUUu|u- ----aaaua- u-a-a-auau aaaa-cuua- -ucuua---- 7741 -----(---- ----)----- ---------- ---------- ---------- ---------gaa aguuu-u-ua -uua-GA-UA GUUUUGAUG( 8161 GGG)CG-UC- A|UUCUCA(- --------UA UAAAUAAAC- )UGAGUAA|G |U|CCUU-|< 8221 uauaugauua auaaauaauu aaaaaaaaau auaaaauaua uauuaaauau auuaauuaua 8281 uauauacaau uuaaauuauu uauauuauuu uauauaaaua aucuaaaauu gaauaaauaa 8341 uagaaaagag a--------- ---------- ---------- ---------- ->a-gg-uau 8401 -ag|--uaa- ------ (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- ----aaa|AU (A|UAAUA)G UAU-AAc-ua 8761 u-gcauaAAU UACgauCAU( -aaacaa--- )AUGAA-GUA A--------- ---------- 8821 ---------- --------AU AC-------- ---(GUAA-- -)-------- ----GUA-UG 8881 G|---UAUAA UGAAC-AUUU AC-U------ ---------- AUA(------ ---------- 8941 ---------- ---------- ---------- ---------- ----AAUAGU AU)ua|GGUA 9001 AAG-AUAAC- |GGAUAAAAG UUACGC|UAG G|GAUAACAG |G-GUA-A-U AUAACGAAAU 9061 AG(U--ACAU )AUAGUAAGU --UAUGUUUG CC-ACCUCGA UGUC|GA--C U|C|GCCUU| 9121 AU-CC-UAUU GG-UU(--GU AGC)AGCUAA UAAG-GGU|U UGAC(UGUUC )GUCAA-UUA 9181 A--AAAGGC- --ACGUGAGU UGGGUUAAAU AC|UU-C(GU GA)G-CAGUA UGGUUCCUAU 9241 CU|UCUGA-A GU|A|<---- ---------- ---------- ---------- ---------- 9301 >AAUAU-UAU AA-AUA-UAA GUC-UAU-AA AU--(UAGU- AC(-GCAA)G GAUC-)AUUU 9361 A--UA-<--- ---------- ---------- -------->A UUAAUCA-AU GGUGAACUAU 9421 U|aaau-aau ------- 9541 auu-auuUAC GUAG-uauAG CUAA-AUUAA UAAA------ ---------- -------UAA 9601 ---------- --UAAGUAUU (GAAAGC--A UAUGA)A-AU -AC-GAAUUU GU-CUUA--- 9661 -UGGA--U-- -AUAAU-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- ---------u auauagu|GA 9961 UUG(UAUACU A--)UAAUCa uua------- ---------- ---------- ------aaua 10021 g|uuauu-ug --c------- ---------- ---------- ---------- ---------- 10081 ---------- --aaauaauu ucu------- ---------- --------(- ---------- 10141 ---------- -------uuu u)agaaa--- ---------- ---------- ---------- 10201 ----ug--ua u|a|aauaa- CUAau-u--- ---------- ---------- ----a-acua 10261 uauu------ ---------- ---------- --gcaauaua acuucuaauc uauauauuuu 10321 auuuuu--|- ---------- ---------- ---auauaua uuauauauau uaaaca~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.S.cerev 10775 bp RNA RNA 21-JAN-1983 DEFINITION Mitochondria Saccharomyces cerevisiae. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Saccharomyces cerevisiae. ORGANISM Mitochondria Saccharomyces cerevisiae. REFERENCE 1 (bases 1 to 6463) AUTHORS No information JOURNAL Feb. 21 1983 STANDARD No information COMMENTS Organism information Culture collection: ? Sequence information (bases 1 to 10775) Corresponding GenBank entry: J01527 Phylo:Mitochondria,Fungi,Saccharomyces BASE COUNT 1403 a 280 c 419 g 1171 t 7502 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~agu aaaaagua-g aauaauagau u-ugaaauau --uuau---- ---------- 241 -----uau-- ---------- ------auag --auuUAAAG AGAUAAUCA- ----UGGAGU 301 |AUA--aua| auu-aaau-u u|aauaaauu uaauauaacu auuaauaga| -auua(-ggu 361 uac------) u|aauaaau- uaauaac|aa u-uaau-(-u uuaaaaccua aggg(uaaa) 421 ccuuuau)-a uuaauaa--u guuauuu--- uuua------ ------uuau auuu------ 481 ---------- ---------- ---------- auaauaag-- ---------- -(-aau-a)- 541 ---------- --auuauuaa uaa<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- --uaauAAAC |UAAGUGAAC 841 UGA(AACA)U CUAAGUA--- -ACUUA---- ---------- ---------- ---AGGAUAA 901 GAAAUC(-AA CA)GA-G-AU |AUU-AUGA- -GUAU-U(-G GUGA)GAGAA -AAUAAUAA- 961 -AGGUCU------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> ---------- ---------- ---|-(---) 1321 ---------- ---------- ---------- ---------- ---------- ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- ---AAGUAUU AUGUGA(--- ---------- 1561 ----aaa)AA AUGUAAGAAA ----auAGGA U(AACAA-A) --UUCUA--A GACUA-AAUA 1621 ---cu-a-uu a-auaagUAU AGU------- --AAGUACC( -GUAA-)GGG ---AAA-GU- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 --AUGAAAAU GAUU-AUU-U U-<------- ---------- ---------- ---------- 1861 ----->AUAA GCAAUCAUGA Auaua---<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (---uuauau 2041 --)---uaua UUAAUGAU-G UACCUU(UU- GUAUA)AUGG |GUC-AGCAA GU-----AA- 2101 UUAAUAUUAG UAA--aac-- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ------aaua a)-------- ----gu-uau 2521 aaa-(-uaaa )--uag---- ---------- ---------- ------uuaA UUAAU-AUUA 2701 AUU-GACCCG AA-AGCAA-A CG-AUCUAAC UAU-GAU-AA GAUG------ g--------- 2761 -(-------- ---------- ---------- ---------- ----auaaa) ------c--- 2821 -GAUCGAA-C AG-GUUGAU( GUUGCAA-U) AUCA-UCUGA --UUAAUUG- UGGUUAG-UA 2881 GU(G-AAAG) ACA-AAUC-U G-GUUUGCAG AUAGCU-GGU UUUCU--AUG AA-AUA-UAU 2941 (-GUAA)GUA UA-GC-CUUU AUaa<----- ---------- ---------- ---------- 3001 ---------- -----auaau aauuauuaua uaauauuaua uuaauau>ua uau|-AAAGA 3061 A|UGGUAC|A GCAAUUA-AU AUauau--ua gggaacu-(a uuaa----)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->-aguu uua-uu-aau 3301 aAU--Au-UA AAUCUCGA-- AAUA|-UUUa -a-uu--aua ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -uau--AA-U -AAAG-AGUC AGAUU--AU- GU-GC(-GAU 3481 AAG)GUAAAU AA-UC----U AAAGGG(AAA -CAG)CCC-A GAUUAAG--A -UA-UAA--- 3541 --AGU-UCCU -AAU-AA-A- UAAUAAGUG- --------AA AUAA--AUA- UUAAAAUAUU 3601 AuA------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AUAUA-AUCA G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->UUAAU-G GGU(UUGACA 3781 AU-A)-ACCA -UUUU|U(U- AA)U|GAACA U(--GUAACA )AU|-GCAC- UGAUUUUAA-UA-U -UU-AAA|-A UCAAAUAUau auauauauau uuguuaauag auaaUAUACG 3961 GAUCU----- ---------- ---------- ---------- uaauaauaa- ---------- 4021 ---------- ---GAAUUAU UUAauuccua auauggaaua uuauauuuuu auaauaaaaa 4081 uauaaau|AC UGAA--UAU| C--U-AA|AU Auuauuauua c--------- --uu(uuuuu 4141 u-uu)aa--- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)-ua auaauaa-UA -U-----GGU AAUAG-AA|- CA-UUUAAUG A---UAAuau 4501 ---------A UAUUA-GUUA (uuaau--)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->UA AUA--UAU-G U|AUUA---| -AUUAAAUAG AGAAUGC-UG 4681 AC|AUGAGUA -ACGA-AAA- AAA-GG-U-- (auaa----- ---------- ---------- 4741 ---------- -----)---A CCUUUu|CAC C-UAAA-ACA UAA--GGUU- -|----ua-- 4801 ---------- ---------- ----(--acu a-)---|--- ---uaa---- ---------- 4861 ---aagua-- -CGGCCCCUA A-U-U-A--- ---aau-(ua auaagaauau aaauau)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--auu---- -----U-AAG AU-GGGAu-- ----(aaucu auauuaauaa a--------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- --aauu--u- -aucu----- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 ---- agauCAGGA- ----AA-Uaa uu---- ---------- ---------- -ACCGUA|AU 6481 G--UAGACC- -(GACUCA)G G|UAUGU-AA GUA-(GAG-A A-----)-UA UGAAGGUGA| 6541 |--AUUAG-A U--AAUUAAA -GGGA-AGGA ACUCGGCAAA GAUAGC-UCA UAAG(UUAGU 6601 )CAAUAAAGA GUA|------ ---------- -----(---- ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->------ ---------- 6781 ----|-(-au )a--agaaCA AAGUUGUA|C AA---CUG-U UU(ACUAA)A AA-CACC-GC 6841 ACUUUG|CA- -GAAAC---- ---------- (--gauaa-- ------)--- ---------- 6901 GUUUAAGUA- UAA-GGUGUG AACUCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CU-CC-AU|G CUUAAU-AUa UAAAUA-AA- 7021 --AUUAUu-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------u aac)----gA UAAU--uuAA U-UAAAuu-| 7141 UA-GGUA-AA U-|AG-C|-A -GCCUU-(AU -UAUG)AGGG UU|A(UAA)- UG-UAGCGAA 7201 AUU-CC-U-U |GGCCUA(-U AAUU-)GAGG UC|CC-GCAU GAAUGACGUA A-UGAUACAA 7261 CA-------- ---------- -------ACU GUCUCCCCUU UAAG-CU-AA ----GUGAAA 7321 UU|G|AAAUC GU-AG(U-GA AGAUG)CUAU GUA----CCU UCAGCAAGAC GGGAAG-ACC 7381 CUAUGC-|-A GCUUU--ACU GU|--A-AUU AGA--uaga| gaauu- au-----ugu -uuauuaua- uuc---AGCA 7501 UAUUAAGUA- -AUC------ ---------- -- --(------- -)-------- -------GAU 7681 AUUAAUGAGA UACUUAu|u- ----auaau- aua-a-ugau aauu-cuaau ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------AGAC AAUCU-C--A -AUU-GG-UA GUUUUGAUG( 8161 GGG)CG-UC- A|UUAUCA(- --------GC AAAAGUAUC- )UGAAUAA|G |U|CCau-|< 8221 aaauaaauau auaaaauuau ugaauaaaaa aauaauauau auuauauaua uuaauuauaa 8281 auugaaauau guuuauauaa auuuauauuu auugaauaua uuuuaguaau agauaaaaau 8341 ---------- ---------- ---------- ---------- ---------- ->A-UG-UAC 8401 -AG|--UAa- ------ (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- ----uUA|AU (A|UAAUG)G UAU-AAC-UG 8761 U-GCgAUAAU UGUAA-CAC( -aaacga--- )GUGAA-ACA A--------- ---------- 8821 ---------- --------GU AC-------- ---(GUAA-- -)-------- ----GUA-UG 8881 G|---CAUAA UGAAC-AAAU AA-C------ ---------- ACU(------ ---------- 8941 ---------- ---------- ---------- ---------- ----GAUUGU AA)AG|GUUA 9001 UUG-AUAAC- |GAAUAAAAG UUACGC|UAG G|GAUAACAG |G-GUA-A-U AUAGCGAAAG 9061 AG(U--AGAU )AUUGUAAGC --UAUGUUUG CC-ACCUCGA UGUC|GA--C U|C|AUCAU| 9121 UU-CC-UCUU GG-UU(--GU AAA)AGCUAA GAAG-GGU|U UGAC(UGUUC )GUCAA-UUA 9181 A--AAUGUU- --ACGUGAGU UGGGUUAAAU AC|GA-U(GU GA)AUCAGUA UGGUUCCUAU 9241 CU|GCUGA-A GG|A|<---- ---------- ---------- ---------- ---------- 9301 >AAUAU-UAU CA-AAU-UAA AUC-UCA-UU AU--(UAGU- AC(-GCAA)G GACC-)AUAA 9361 U--GA-<--- ---------- ---------- -------->A UCAACCC-AU GGUGUAUCUA 9421 U|-UGA-UAA ------- 9541 UUA-UCAUAG UAGA--UAAG CUAA-GUUGA UAA------- ---------- -------UAA 9601 ---------- -AUAAAUAUU (GAAUAC--A UAUUA)A-AU -AU-GAAGUU GU-UUUA--- 9661 -AUAA--G-- -AUAAU-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- --------ua aucugau|AA 9961 UUU(UAUACU A--)AAAUUA Auaau----- ---------- ---------- ------uaUA 10021 G|GUuuuaua uau------- ---------- ---------- ---------- ---------- 10081 ---------- --uauuuaua aauaaauaua uuauaauaau aauaauua(u uauuauuaau 10141 aaaaaauauu aauuauaaua u)-------- ---------- ---------- ---------- 10201 --------ua a|u|aaaAUA CUAau-u--- ---------- ---------- ----u-auca 10261 guuaucuaua uaaua----- ---------- --------uc uaaucuaauc uauuauucua 10321 uauacu--|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.W.satur 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Williopsis saturnus var. mrakii.. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Williopsis saturnus var. mrakii. ORGANISM Mitochondria Williopsis saturnus var. mrakii. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: X71392 ID MIWMTRNAV standard; DNA; ORG; 3709 BP. XX AC X71392; XX DT 16-APR-1993 (Rel. 35, Created) DT 16-APR-1993 (Rel. 35, Last updated, Version 2) XX DE W.mrakii mitochondrial DNA for tRNA-Val, 15S rRNA and 21S rRNA DE (partial) XX KW 15S ribosomal RNA; 21S ribosomal RNA; ribosomal RNA; KW small subunit ribosomal RNA; transfer RNA; transfer RNA-Val. XX OS Williopsis mrakii OC Eukaryota; Plantae; Thallobionta; Eumycota; Hemiascomycetes; OC Endomycetales; Saccharomycetaceae. XX OG Mitochondrion XX RN [1] RP 1-3709 RA Drissi R.; RT ; RL Submitted (07-APR-1993) on tape to the EMBL Data Library by: RL R. Drissi, Institut Curie Biologie, Bat 110 Centre Universitaire, RL 91405 Orsay Cedex 13, FRANCE XX RN [2] RP 1-3709 RA Drissi R., Sor F., Fukuhara H.; RT "DNA sequences coding for the ribosomal small subunit RNA and Vayl RT tRNA from the lineard mitochondrial genome of Williopsis mrakii"; RL Unpublished. XX FH Key Location/Qualifiers FH FT source 1..3709 FT /organism="Williopsis mrakii" FT /mitochondrion FT /strain="CBS 1707" FT promoter 42..50 FT /note="15S rRNA promoter" FT rRNA 50..1666 FT /product="15S ribosomal RNA" FT tRNA 1822..1895 FT /product="tRNA-Val" FT promoter 1955..1963 FT /note="21S rRNA promoter" FT rRNA 1963..>3709 FT /product="21S ribosomal RNA" XX SQ Sequence 3709 BP; 1530 A; 324 C; 497 G; 1358 T; 0 other; BASE COUNT 741 a 153 c 246 g 607 t 9028 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 301 |~~~~~~~~| ~~~~~~~~~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~(~~~~ 361 ~~~~~~~~~) ~|~~~aaau- uaauaa---- ---------- --aaaa--u- -----uga-- 421 -----au-a- ------a--u guuaugaug- --uac----- ag-------- -------auu 481 -uga-aaagu gu-ugua--- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---------- ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- -------uga cauuaacggg uuauucaagg 721 aauauauugc uauuaauaaa uaagguuaau aauaauauaa aauauauaua uauugauaua 781 uauauauuga uauauuuaau accuaaggga aaccauaa>- --uaauAAAC |GUGAAGAAC 841 UGA(AUCA)U CUAAGUA--- -UUCAU---- ---------- ---------- ---AGGAAAA 901 GAAAUC(-AA AA)GA-G-AU |AUU-AUGA- -GUAA-U(-G GCGA)GUGAA -AGUAAUaa- 961 -agucgu<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> ---------- ---------- ---|-(---) 1321 ---------- ---------- ---------- ---------- ---------- --<-uaguaa 1381 aaau------ ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- ---aaguauu auuuua(--- ---------- 1561 ---ucaa)ga aaGUAAGAAA ----auAGAU -(AACUA-A) --AUCUA--A GACUA-AAUA 1621 ---UU-AUUA A-UAAGC-AU AAA------- --AAGUACC( -GAAA-)GGG ---AAA-au- 1681 a--------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 --uga-aaug ga-u-aau-c u-<------- ---------- ---------- ---------- 1861 ----->AUAA GCaacaugag auuu----<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--auuaaaa 2041 --)---uaga uuuaaugu-G UACCUU(UU- GCAUA)AUGG |GCC-AGCAA GU-----AA- 2101 UGUAAUUUAG CAA--aau-- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- ------auau u-auau-uau 2521 aua---uaaa ---uag-aau a--------- uauaaugau- ----aa--au uaauuuauug 2581 aa-------- ---------- ---------- ---------- ---------- ---------- 2641 ------aaau guuaa----- ---------- ---------- ---u---AAG UUAAA-UUAC 2701 AUU-GGCCCG AA-AAUAA-A AG-AUCUUAU UAU-UAC-AA GAUAuau--- ---------- 2761 -(-------- ---------- -------aau uaaugaaaau uaauuuauu) ---------- 2821 -GAUCGAA-U GG-GUUAAU( GUUGCAG-U) AUUA-UCCAA --UUAGUGA- UGAUAAGUAA 2881 GU(G-AAAG) ACU-AACC-U G-UUUUAUAG AUAGCU-GGU UCUCU--GUG AA-AUA-UAU 2941 (-GUUA)GUA UA-GC-gauu uaau<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------a>aa aua|-auuau 3061 a|agguau|a gcacuua-au auuuu----- ---------- ---------- ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------a 3241 auuauca-uu aauuuauuaa ugauaaaugg ggguuaauaa uuaa------ -cu-ua-uca 3301 uguauau-uu aaucucau-- aaua--uuau -a-au--uau ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -aaa--uu-a -aauu-AGUC AGACU--AU- AU-GC(-GAU 3481 AAG)GUUUAU AG-UC----G AAAGGG(AAA -CAG)CCC-U AAAUUAC--A -UU-UAA--- 3541 --GGU-UCCA -AAAUAU-G- GAUUAAGUG- --------aa uaaaaugua- uuaauuguca 3601 u--------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AAUCA-AUUA G<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->UUGGU-G GGU(UUGACA 3781 AU-A)-ACUA -UCCU|A(U- AA)U|GAACA U(--GUAACA )AU|-GCAC- UAAUAUucg-au-a -au-uaa|ua cagauaa--- ---------- ---------- ----UAUACG 3961 GAUCU----- ---------- ---------- ---------- cgu------- ---------- 4021 ---------- ----AAAUCC AUU------- ---------- ---------- ---------- 4081 -------|AC CGAU--AAU| G--A-AU|au auuaauauau -------ucu uccgugucgg 4141 augc(cacuc )gcgucgccc ucggacuaaa uaa------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)-au auauuaa-UA -U-----GGU AACAG-AG|- CA-UAUAAUA A---ACUuua 4501 u--------a uaaua-auua (-------)< gauuaauuau uauauuauau aauuauaaua 4561 uaauuauaua cuuaauaaau auauaacuuu aauuuauuuu uaaaauaaau guauugaaua 4621 aauau----- ------->uu auu--auu-a a|UAGUU--| AAUUAUAUUG AUAAUGC-UG 4681 GC|AUGAGUA -GCGA-AAA- AUA-AGUAU- (--aau---- ---------- ---------- 4741 ---------- -----)-u-u uuuau-|aaa u-uaua-uaa acu--uauuc -|---acaua 4801 ---------- <--------- --->(--aua ca)---|--- -uaugg---- -------uuu 4861 uacuauaaau uCGGUCCUUA A-GUU-G--- guuuac-(ag auuua----- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-guaa---a -----C-ACG AU-AGGuu-- ----(uaauu uauuauuaua gauauau--- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- --auuu-auu auaua----- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 ---- uguacaaga- ----aa-uaa aua--- ---------- ---------- -ACCGUA|AU 6481 U--AAGACC- -(GACACA)G G|UGUGUAUA GUA-(GAG-A A-----)-UA UGAAAGUGA| 6541 |--AUGGA-U G--AAGUAUU -CGGA-AGGA ACUCGGCAAA AAAUAC-CUC CACG(UUUGU 6601 )CAAUAAAGG GAA|------ ---------- -----(---- ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->------ ---------- 6781 ----|-(auu )a--aaaaUA AGAUUAUA|C AA---CUG-U UU(ACUAA)A AA-CACA-GC 6841 ACAUUG|CG- -GAUAU---- ---------- (--aaaa--- ------)--- ---------- 6901 AUAUUAGUA- UAA-UGUGUG Aauuc~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 6961 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ 7021 ~~~~~~~~~~ ~~(~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| 7141 ~~~~~~~~~~ ~~|~~~~|~~ ~~~~~~~(~~ ~~~~~)~~~~ ~~|~(~~~)~ ~~~~~~~~~~ 7201 ~~~~~~~~~~ |~~~~~~(~~ ~~~~~)~~~~ ~~|~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7321 ~~|~|~~~~~ ~~~~~(~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7381 ~~~~~~~|~~ ~~~~~~~~~~ ~~|~~~~~~~ ~~~~~~~~~| <~~~~~~~~~ ~~~~~~~~~~ 7441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~>~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> ~~(~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ 7681 ~~~~~~~~~~ ~~~~~~~|~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7741 ~~~~~(~~~~ ~~~~)~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~<~ 7801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~>~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( 8161 ~~~)~~~~~~ ~|~~~~~~(~ ~~~~~~~~~~ ~~~~~~~~~~ )~~~~~~~|~ |~|~~~~~|< 8221 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8281 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8341 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~>~~~~~~~~ 8401 ~~~|~~~~~~ ~~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8461 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8521 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8581 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8641 ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8701 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~|~~ (~|~~~~~)~ ~~~~~~~~~~ 8761 ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8821 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~(~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ 8881 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~(~~~~~~ ~~~~~~~~~~ 8941 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~)~~|~~~~ 9001 ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~|~~~ ~|~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 9061 ~~(~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~|~|~~~~~| 9121 ~~~~~~~~~~ ~~~~~(~~~~ ~~~)~~~~~~ ~~~~~~~~|~ ~~~~(~~~~~ )~~~~~~~~~ 9181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~|~~~~(~~ ~~)~~~~~~~ ~~~~~~~~~~ 9241 ~~|~~~~~~~ ~~|~|<~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9301 >~~~~~~~~~ ~~~~~~~~~~ ~~~-~~~~~~ ~~~~(~~~~~ ~~(~~~~~)~ ~~~~~)~~~~ 9361 ~~~~~-<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.S.sinus 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Suillus sinuspaulianus. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Suillus sinuspaulianus. ORGANISM Mitochondria Suillus sinuspaulianus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: UNP00109 ; sequence of mt-LrRNA of S. sinus start at Cla I and end at EcoR I, sequence ; almost double-direction sequenced ; 5' and 3' termini unknown FULL_MTLRRNA_SINUS_CLAI_TO_ECORI BASE COUNT 1572 a 509 c 737 g 1398 t 6559 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~aucgau gacauauu-- --guuuuaac aucaa----- 241 --aaaaaaa- -------uuu aauuuauaag uauuuUAAAG GGGUUAUUA- ----AGGAUA 301 |ACU--AGC| AAA-UUUA-U A|aaaaag-- ---------- ----gagg-- -caaaa-gcc 361 a-aa-----a g|ccaucaa- uacagau-aa a-auuauaau uuuauauaug gaaucugugu 421 gcgagaaugu ggcg------ ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- -aucuaaggg aaaccu-ua- 541 ---------- ---------- ---<------ ---------- ---------- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- uuauuaUUAC |UUCCCGAAG 841 UAA(AACA)U UUCAUUA--- -GGGAA---- ---------- ---------- ---AGGAAAG 901 GAAAUC(-AA CC)GA-G-AC |UCC-GAAA- -GUAA-U(-G GUGA)GUGAA -AUCGGAUU- 961 -AGCCUG<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- --auuuuuuu uauauaaaau aaaaauugau uaaaaauaua uuuaauuuua 1081 uucuuauuua aagaugacaa aauaagugaa aguuaaaau- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- --------cu ggugaaagu< ---------- ---------- 1261 ---------- ---------- ---------> (ggaa--)au uucau----- ua-|a(gaa) 1321 uaacuua(ac aaau-)uaaa uu--aguuuu uaguaugagu aaauau---- ----AAGUACG AUGAGA(--- ---------- 1561 ---gaua)AC UUGUCGGAAU ----auAGGG G(AACCA-U) -CCUCUA--A GGCUA-AGUA 1621 ---UuaUAAA U-UUAGCGAU AGUG-AA--- -AAAGUACC( -GUGA-)GGG ---AAAAGU- 1681 ugaaaagugu gagggucaau aauuauuaga uauagcuaga aauaauauau ugagaauuau 1741 aacccuugaa aguaaau--a acgc------ ---------- ------AGUG AA--AUAG-- 1801 ACUUG-AAUU AGUA-ACU-C U-<------- ---------- ---------- ---------- 1861 ----->AUAA GCAGUCGAAA Uuucu---<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ------uuaa aauagaacg> (--------- 2041 --)---agag AUGACGGC-G UACCUU(UU- GCAUA)AUGG |GUC-AGCAA GU-----UA- 2101 AUAGGAGUAG CAA--gguua a------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ------aaac c)-------- --uuag-cga 2521 aag-(-cga- )--cugucaa aa(aaga--) ua-augg--- -----guaaG UUACU-UCUA 2701 UUA-GACCCG AA-GCCAG-G UG-AUCUUUC UAG-GAC-CA GAUU------ ---------- 2761 -(-------- ---------- ---------- ---------- ---auaaug) ---------- 2821 -GAUCGAA-C GG-GUGAAU( GUUGCAU-A) AUUC-UCCGA --AGAGUCC- UUGAAAG-CG 2881 GC(G-AAAU) ACC-AAUC-U G-ACCUGGUG AUAGCU-GGU UUUCU--ACG AA-ACA-UAU 2941 (-UUAA)GUA UG-AC-AUCU ACAC<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->aa AAU|-UUAUG 3061 G|AGGUAC|A GCACggc-aa uu-ccc---- ---------- ---------< aacaaguuuu 3121 ag-------- ---aauagua cauuu----- ---------- ---------- ---------- 3181 ---------- --------uu au-------- ---------- -aaauuuauu uauuuuauua 3241 gga------- guuuagguug cggggaccuc gaaaaucuua ccaa>----- --------ug 3301 gaa---g-ug aAACUCGG-- AAUU|-ACAU -A-A---AUU ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -gau--GG-U -AGAU-AUUC AGACU--GC- UC-AU(-GCU 3481 AAG)UUGGGU AG-UC----A AGACGG(AAA -CAG)CCG-A GAACA-CauG -AU-UAA--- 3541 --GGU-CCCC -AAU-GA-U- UAUUAAGUG- --------AA AUAAAGGAA- GUAACAAAUU 3601 G-A------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AUGCA-GCUG U<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->AAAGU-G AGC(UUGGUA 3781 GU-A)-GCUA --CUU|A(U- AA)U|GAUCG U(--GUAACA )AC|-GCAU- CAGCCCUAG-AG-U -GU-UGC|-G CCGAAAAU-- ---------- ---------- ----UCAACG 3961 GGUCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---uAAAUAA UCA------- ---------- ---------- ---------- 4081 -------|AC CGAU--AUC| G--U-GU|UA Auuuuaaaua aaaauuuauu auuuguuuau 4141 aauuuauaga caaauauauc auaaacuuuu uauaaauaau uaauuauaca aaauaaaauu 4201 uuaucuugaa cuauuaauua auuauuuguu auuuaauuua auuauuuaaa aauuaauaua 4261 aauuaguuua auauuuccca uuuauaugaa auauguuaau aaaaaaaaua auacaaauuu 4321 uuaaauaauu aauuuuguuu uuaauaguuu aaaguauaau auaaauauaa uuuauaauua 4381 gauuuuuaua uuguuaauau auuauauuua ucuuaauuua auauauuauc uuuauuuu(- 4441 ------)--a uuuaaaauCU -A-----GGU AGUAG-AA|- CA-UUCAGAU A---UUUuaa 4501 auccccauga uuaac-agug (uuu----)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->ca uug--uuc-a u|AGGA---| AUCUGAAGAG AUAAUGC-UG 4681 AC|AUGAGUA -ACGU-AAAa aga-aa-g-- (aaaaaauua gaucgagagg ucuuugaagu 4741 uuuaaa---- -----)---c uuucu-|CGC C-GAAU-ACG AAA--GGGUu -|----auua 4801 gcuaa---ag <--------- --->(-auua aa)u-c|-aa cuaaug---- ---------- 4861 ---uuauag- -CGGUCUCUA A-G-G-U--- acaaaac(-c aau------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-guuu---u g----G-CUG AU-GAGuu-- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- -ACCGUA|CC 6481 C--UAAACC- -(GACACA)G G|UUCGU-AG GUA-(GAG-U A-----)-UA CUAAGGCG-| 6541 |--UAGAG-C U--AAAAGUU -GUUA-AGGA ACUCGGCAAA UUAUCC-UCA UAAG(UUCGA 6601 )CGACAA-GA GGA|------ ---------- -----(---- ---)------ ---------- 6781 ----|G(GCA )C--AAAAUC GGAAGCCC|C GA---CUG-U UU(ACUAA)A AA-CACA-GC 6841 UAUCUG|CA- -ACGAU---- ---------- (--GUAA--- ------)--- ---------- 6901 AUCAUAGUA- UAG-GUAGUG AGGUUU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-AU|G CCAUUA-AUA UAAGAG-AAg 7021 --UGAUGG-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------g uaa)----CU GUUA-aUUAU C-GAAAAU-| 7141 CU-GGUU-AA U-|AG-C|-G -GUCUU-(AA CUAUG)AGGA UC|C(UAA)- GG-UAGCAAA 7201 AUA-AA-U-U |GGCCAU(-U AAAU-)GUGG UC|CG-GUAU CAAUAAUUUA A-CGAUGGCU 7261 UC-------- ---------- -------ACU GUCUCUACAA CUUG-CU-CA ----GUGAAA 7321 UU|G|AAUUA CC-CG(U-GC AGAUG)CGGG UUG----CCA CCAGGGGGAC GGGAAG-ACC 7381 CUAUGC-|-A GCUUC-UACU GU|--A-GUU AAU--CAUC| auuaa- ucuagaacaa -ccuuaguc- aau---AGCA 7501 AAUAGGUAU- -GUC------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----gau a)-------- -------gac 7681 aaaaauugga agaccuu|aa ---gucuag- g-g-u-uggg uuaa-uguuu accu-uu-uu 7741 auuu-(--aa caca)-aaau ---------- ---------- --------aa ---aaugg<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->GAGA GCUGA-U-UG -AUU-GG-CA GUUUGACUG( 8161 GGG)CG-GU- C|GUCUUU(- --------AA UAGAGUAGC- )AAAGUAC|A |U|CCaa-|< 8221 auauaaaauu aauuauaaaa uauuuacuau uaa-uaauau uaauguguaa auauucucac 8281 aaauaucaua uugcuguaaa uuuuuaauuu acuuuaacau caauuuuuau uuuuuguuuu 8341 uaua------ ---------- ---------- ---------- ---------- ->A-GG-UAU 8401 AGC|--UA-- ------<--- gaaauuga(a uggaga)uca au-------- -------uaa 8461 cc(agugaua a)gguuaugg a--------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -----GG|GC (G|CAAUG)G CGGUAAG-CA 8761 U-GC-UUAAC UGAUA-GAC( -uuaaaa--- )GUCGC-ACA G--------- ---------- 8821 ---------- --------AU AC-------- ---(GUAA-- -)-------- ----GUA-GG 8881 G|---CAUAG UGACC-CCUC GC-U------ ---------- AUA(------ ---------- 8941 ---------- ---------- ---------- ---------- ----UUAUGG A-)UA|GACG 9001 GGA-UCAAU- |UGAUAAAAG UUACGC|UAG G|GAUAACAG |G-CUG-A-U AGCCGGCGAG 9061 AG(U--ACAC )AUUGUCCCG --GCUGUUUG GC-ACCUCGA UGUC|GA--C U|U|AUCCU| 9121 AU-CC-UCCG GG-GG(--AA -GA)AGCUUG GAAG-GGU|U CGGC(UGUUC )GCCGA-UUA 9181 A--AAGGUU- --ACAUGAGU UGGGUUUAAU AC|GA-C(GU GA)GUCAGUA UGGUCCCUAU 9241 CU|UCUGG-U GG|G|<---- ---------- ---------- ---------- ---------- 9301 >ACAAA-UAG UA-AAA-AGG GGG-aga-cc uuc-(CAGU- AC(-GAAA)G GACCa)auag 9361 g--au-<--- ---------- ---------- -------->G UGUUUCU-CU AGUGUACCAA 9421 U|-UGU-UGA ------- 9541 UUG-GCAUAG UUGG--GUAG CCAC-AAACA UAU------- ---------- -------UAG 9601 ---------- -AUAAGAGCU (GAUUGU--A UAUAA)A-GC -AC-GAAACU AUCCCCU--- 9661 -AGAU--A-- -CUAUC---| ------(--- )--------- ---auua|ag 9961 aaa(uagaac a--)uuucuu u--------- ---------- ---------- ------aaua 10021 g|gaugcaaa ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---ugaauuc ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.S.luteu 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Suillus luteus. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Suillus luteus. ORGANISM Mitochondria Suillus luteus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: UNP00110 Thesis: Yunan Li, University of California at Berkeley BASE COUNT 348 a 168 c 224 g 315 t 9720 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 301 |~~~~~~~~| ~~~~~~~~~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~(~~~~ 361 ~~~~~~~~~) ~|~~~~~~~~ ~~~~~~~|~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ 421 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~(~~~~ 481 )~~~|~~~~~ ~~(~~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~)~ 541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~<~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 601 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 661 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ |~~~~~~~~~ 841 ~~~(~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~(~~~ ~~)~~~~~~~ |~~~~~~~~~ ~~~~~~~(~~ ~~~~)~~~~~ ~~~~~~~~~~ 961 ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~>~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~< ~~~~~~~~~~ ~~~~~~~~~~ 1261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~)~~ ~~~~~~~~~~ ~~~|~(~~~) 1321 ~~~~~~~(~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ 1381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ >~~~~~~~~~ ~~~~~~(~~~ ~~~~~~~~~~ 1561 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~)~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~>~~~~ ~~~~~~~~~~ ~~~~~~~~<~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~~~~ 2041 ~~)~~~~~~~ ~~~~~~~~~~ ~~~~~~(~~~ ~~~~~)~~~~ |~~~~~~~~~ ~~~~~~~~~~ 2101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2221 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2281 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2341 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2401 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2461 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ 2521 ~~~~(~~~~~ )~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2581 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2641 ~~~~~~~~~~ ~~~~~>~~~~ ~~(~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2701 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2761 ~(~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~) ~~~~~~~~~~ 2821 ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2881 ~~(~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2941 (~~~~~)~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 3001 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~>~~ ~~~|~~~~~~ 3061 ~|~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~< ~~~~~~~~~~ 3121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 3181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 3241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~>~~~~~ ~~~~~~~~~~ 3301 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 3361 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 3421 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~(~~~~ 3481 ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~(~~~ ~~~~)~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 3541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 3601 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 3661 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~<~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 3721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~>~~~~~~~ ~~~(~~~~~~ 3781 ~~~~)-~~~~ ~~~~~|~(~~ ~~)~|~~~~~ ~(~~~~~~~~ )~~|~~~~~~ ~~~~~~<~~~ 3841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 3901 ~>~~~-~~~~ ~~~~~~~|~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 3961 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4081 ~~~~~~~|~~ ~~~~~~~~~| ~~~~~~~|~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4321 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ 4441 ~~~~~~)~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ 4501 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~)< ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4621 ~~~~~~~~~~ ~~~~~~~>~~ ~~~~~~~~~~ ~|~~~~~~~| ~~~~~~~~~~ ~~~~~~~~~~ 4681 ~~|~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4741 ~~~~~~~~~~ ~~~~~)~~~~ ~~~~~~|~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~|----~~~~ 4801 ~~~~~~~~~~ <~~~~~~~~~ ~~~>(-~~~~ ~~)~~~|~~~ ~~~~~~~~~~ ~~~~~~~~~~ 4861 ~~~~~~~~~~ ~~~~~~~~~~ ~-~~~~~~~~ ~~~~~~~(~~ ~~~------- ------)<~~ 4921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~-- 4981 >-~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~(~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~)~~~~~ |~~~~~|~~~ ~~~~~~~~~~ |~~<~~~~~~ 5101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5221 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5281 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5341 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5401 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~>~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5461 ~~~~~(~~~~ ~~~~~~)~~~ ~~~|~~~~~~ ~~~~~~~~|~ ~~~~~~~~~~ ~(~~~~~)~~ 5521 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~(~~~~ )~~~~~~~~~ ~~~~~~~~~~ 5581 ~~<~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5641 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~>~~ ~~~~~~~~~~ ~~~~~~-~~~ ~~~<~~~~~~ 5701 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5761 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5821 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5881 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 5941 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 6001 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 6061 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 6121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 6181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 6241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 6301 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 6361 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 6421 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~|~~ 6481 ~~~~~~~~C- -(GACACA)G G|UUCGU-AG GUA-(GAG-U A-----)-UA CUAAGGCG-| 6541 |--UAGAG-C U--AAAAGUU -GUUA-AGGA ACUCGGCAAA UUAUCC-UCU AAAG(UUCGA 6601 )CGACAA-GA GGA|------ ---------- -----(---- ---)------ ---------- 6781 ----|G(GCA )C--AAAAUC GGAAGCCC|C GA---CUG-U UU(ACUAA)A AA-CACA-GC 6841 UAUCUG|CA- -ACGAU---- ---------- (--GUAA--- ------)--- ---------- 6901 AUCAUAGUA- UAG-GUAGUG AGGUUU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-AU|G CCAUUA-AUA UAAGAG-AAG 7021 --UGAUGG-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------g uaa)----CU GUUA-aUUAU C-GAAAAU-| 7141 CU-GGUU-AA U-|AG-C|-G -GUCUU-(AA CUAUG)AGGA UC|C(UAA)- GG-UAGCAAA 7201 AUA-AA-U-U |GGCCAU(-U AAAU-)GUGG UC|CG-GUAU CAAUAAUUUA A-CGAUGGCU 7261 UC-------- ---------- -------ACU GUCUCUACAA CUUG-CU-CA ----GUGAAA 7321 UU|G|AAUUA CC-CG(U-GC AGAUG)CGGG UUG----CCA CCAGGGGGAC GGGAAG-ACC 7381 CUAUGC-|-A GCUUC-UACU GU|--A-GUU AAU--CAUC| auuaa- ucuagaacaa -cuuuaguc- aau---AGCA 7501 AAUAGGUAU- -GUC------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----gau a)-------- -------gac 7681 aaaaauugga agaccuu|aa ---gucuag- g-g-u-uggg uuaa-uguuu accu-uu-uu 7741 auaa-(--gc aaaa)-uuau ---------- ---------- --------ag ---aaugg<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->GAGA GCUGA-U-UG -AUU-GG-CA GUUUGACUG( 8161 GGG)CG-GU- C|GUCUUU(- --------AA UAGAGUAGC- )AAAGUAC|A |U|CCaa-|< 8221 auauaaaauu aa-uaaaaaa uauuuacuau uaaauaauau uaauguguaa auauucucac 8281 aaauaucaua uugcuguaaa uuuuuuauuu acuuuaacau caauuauuau uuuuuguuuu 8341 uaua------ ---------- ---------- ---------- ---------- ->A-GG-UAU 8401 AGC|--UA-- ------<--- gaaauuga(a uggaga)uca au-------- -------uaa 8461 cc(agugaua a)gguuaugg a--------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -----GG|GC (G|CAAUG)G CGGUAAG-CA 8761 U-GC-UUAAC UGAUA-GAC( -uuaaaa--- )GUCGC-ACA G--------- ---------- 8821 ---------- --------AU AC-------- ---(GUAA-- -)-------- ----GUA-GG 8881 G|---CAUAG UGACC-CCUC GC-U------ ---------- AUA(------ ---------- 8941 ---------- ---------- ---------- ---------- ----UAAUGG AA)UA|GACG 9001 GGGAUCAAU- |UGAUAAAAG UUACGC|UAG G|GAUAACAG |G-CUG-A-U AGCCGGCGAG 9061 AG(U--ACAC )AUUGUCCCG --GCUGUUUG GC-ACCUCGA UGUC|GA--C U|U|AUCCU| 9121 AU-CC-UCCG nn-nn(--nn -nn)nnnnnn nnnn-nnn|n nnnn(nnnnn )nnnnn-nnn 9181 n--nnnnnn- --nnnnnnnn nnnnnnnnnn nn|nn-n(nn nn)nnnnnnn nnnnnnnnnn 9241 nn|nnnnn-n nn|n|<---- ---------- ---------- ---------- ---------- 9301 >nnnnn-nnn nn-nnn-nnn nnn-nnn-nn nnn-(nnnn- nn(-nnnn)n nnnnn)nnnn 9361 n--nn-<--- ---------- ---------- -------->n nnnnnnn-nn nnnnnnnnnn 9421 n|-nnn-nnn ------- 9541 nnn-nnnnnn nnnn--nnnn nnnn-nnnnn nnn------- ---------- -------nnn 9601 ---------- -nnnnnnnnn (nnnnnn--n nnnnn)n-nn -nn-nnnnnn nnnnnnn--- 9661 -nnnn--n-- -nnnnn---| ------(--- )--------- ---nnnn|nn 9961 nnn(nnnnnn n--)nnnnnn n--------- ---------- ---------- ------nnnn 10021 n|nnnnnnnn ---------- ---------- ---------- ---------- ---------- 10081 ---------- ---nnnnnnn ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.T.papil 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondria Trimorphomyces papilionaceus. ACCESSION No information KEYWORDS No information. SOURCE Mitochondria Trimorphomyces papilionaceus. ORGANISM Mitochondria Trimorphomyces papilionaceus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: X73672 ID TPLSRRA standard; DNA; ORG; 2817 BP. XX AC X73672; XX DT 08-JUL-1993 (Rel. 36, Created) DT 08-JUL-1993 (Rel. 36, Last updated, Version 3) XX DE T.papilionaceus mitochondrion gene for large subunit rRNA, exons 1 DE and 2 XX KW large subunit ribosomal RNA. XX OS Trimorphomyces papilionaceus OC Eukaryota; Plantae; Thallobionta; Basidiomycotina; OC Phragmobasidiomycetes; Heterobasidiomycetidae; Eutremellales; OC Tremellaceae. XX OG Mitochondrion XX RN [1] RA Hong S.G.; RT ; RL Unpublished. XX RN [2] RP 1-2817 RA Hong S.G.; RT ; RL Submitted (28-JUN-1993) on tape to the EMBL Data Library by: RL S.G. Hong, Seoul National University, Dept of Microbiology, San RL 56-1 Shinlim-Dong, Kwanak-ku, Seoul 151-742, KOREA XX FH Key Location/Qualifiers FH FT source 1..2817 FT /organism="Trimorphomyces papilionaceus" FT /mitochondrion FT mRNA join(1..1090,2681..2817) FT /note="large subunit RNA" FT /gene="LSU rRNA" FT intron 1091..2680 FT /number=1 FT /gene="LSU rRNA" FT exon 1..1090 FT /number=1 FT /gene="LSU rRNA" FT CDS 1510..2193 FT /note="orf" FT exon 2681..2817 FT /number=2 FT /gene="LSU rRNA" XX SQ Sequence 2817 BP; 952 A; 458 C; 552 G; 855 T; 0 other; BASE COUNT 404 a 196 c 277 g 350 t 9548 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 301 |~~~~~~~~| ~~~~~~~~~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~(~~~~ 361 ~~~~~~~~~) ~|~~~~~~~~ ~~~~~~~|~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ 421 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~(~~~~ 481 )~~~|~~~~~ ~~(~~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~)~ 541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~<~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 601 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 661 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ |~~~~~~~~~ 841 ~~~(~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~(~~~ ~~)~~~~~~~ |~~~~~~~~~ ~~~~~~~(~~ ~~~~)~~~~~ ~~~~~~~~~~ 961 ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~>~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~< ~~~~~~~~~~ ~~~~~~~~~~ 1261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~)~~ ~~~~~~~~~~ ~~~|~(~~~) 1321 ~~~~~~~(~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ 1381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ >~~~~~~~~~ ~~~~~~(~~~ ~~~~~~~~~~ 1561 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~)~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~>~~~~ ~~~~~~~~~~ ~~~~~~~~<~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~~~~ 2041 ~~)~~~~~~~ ~~~~~~~~~~ ~~~~~~(~~~ ~~~~~)~~~~ |~~~~~~~~~ ~~~~~~~~~~ 2101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2221 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2281 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2341 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2401 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2461 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ 2521 ~~~~(~~~~~ )~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2581 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2641 ~~~~~~~~~~ ~~~~~>~~~~ ~~(~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2701 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~ucu auccugc-ca gacu------ ---------- 2761 -(-------- ---------- ---------- ---------- ------aua) ---------- 2821 -GGUCGAA-c gg--uucau( guugcag-u) aug--uccga --ugagcug- aggaugu-ag 2881 gu(g--aag) gcc-aauc-u g-acaaagau AUAGCU-GGU ACUCC--UCG AA-ACG-UAU 2941 (-AUAG)GUA CG-GC-CCUC UAAuua gau|-uuacg 3061 c|AGGUAC|A GCACug--au ug-cc----- ---------- ---------< auacuaugcu 3121 aaac-----a aaaauuuag- ---c------ ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- -----uuauu ua-------- 3241 ---------- guu-caauug -gggga-ucg ugagauucua ccau------ --------ug 3301 gua---g-uu aacCUCGG-- AAUU|-ACGU -aua---auu ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -gau--AU-A -GAGG-AGAC AGACU--AU- UC-AU(-GAU 3481 AAG)GUG-AU AG-UC----G AGACGG(AAA -CAG)CCG-U GAGCA-U-AG -AU-AAA--- 3541 --GGU-CCCA aAAU-AG-U- GGUUAAGUG- --------AA AAUAAGGAa- guuaugaucc 3601 c-C------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AUACA-GCUA U<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->AAAGU-G UGC(UCGGAA 3781 GU-A)-GCAA -UCUU|U(U- AA)u|gauag u(--guaaca )ac|-uua-- --guagagg-au-c -au-agc|-g ccuaagau-- ---------- ---------- -----UAACG 3961 GGUCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---aagacca cuu------- ---------- ---------- ---------- 4081 -------|AC CGAU--ACU| A--U-GC|c- guuaguuguu ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 aauuau)-aa cagcuaa-UU -G-----GGU AGAGG-AG|- CA-UUCAGC- ----auggua 4501 g--------a agaau-agug (uuu----)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->ca uua--uuu-c g|acau---| AGCUGAAGAG AAUAUGC-CA 4681 AC|AUGAGUA -ACGU-AGAa aga-ag-u-- (uauaau--- ---------- ---------- 4741 ---------- -----)---a cuucu-|CGC C-GAAU-GAG AAA--GGGuu -|----ccau 4801 auaaa---ug <--------- --->(--uua aa)c-a|-ga uauggg---- ---------- 4861 ---uuaaaa- -CGGCCUCUA A-G-a-u--- aaauagc(ua uuag------ ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-gcua---u uu---a-uag au-gaguu-- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- -ACCGUA|CC 6481 C--UAAACC- -(GACACA)G G|UUCUC-GG GUA-(GAG-U A-----)-UA CUAAGGCG-| 6541 |--AUGAG-A U--AA--uac -uau--AUAG ACUCGGCAAA U-GCAU-CCG UACA(CUCGA 6601 )UAAGAA-GG AUG|------ ---------- -----(---- ---)------ ---------- 6781 ----|G(ACA )C--AUAAUC GGAGGC-A|U GA---CUGGU UU(ACCAA)A CA-CA---GG 6841 UAUCUG|CU- -AUAAU---- ---------- (-UUAAU--- ------)--- ---------- 6901 UAUGUUGUA- UAG-GUACUG AAUCUU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G UUCCG-AU|G CCAUGA-GUA UAA------- 7021 --UAAUAG-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- --------gg uaauaucuua ucu)----CU GUUA-a-aac c------U-| 7141 CU-GGUC-AA U-|GA-U|-A -GUCUU-(AA CUAUA)AGGA UU|C(UAA)- GG-UAGCUGA 7201 AUG-CCGUGU |GGCCGU(-U AAAU-)GCGG UC|CU-GCAU GAAUAGAGUA A-CAAUGCCU 7261 CU-------- ---------- -------GCU GUCUCAUAUA GUAU-CU-CA ----GUGAAA 7321 UU|G|AAUUA GC-CG(U-GA AGAUG)CGGU UUA----CGU GCGGGUAGAC GGGAgg-gc- 7381 ---------- ---------- ---------- ---------| ~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> ~~(~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ 7681 ~~~~~~~~~~ ~~~~~~~|~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7741 ~~~~~(~~~~ ~~~~)~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~<~ 7801 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7861 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 7981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8041 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~>~~~~ ~~~~~~~-~~ -~~~~~~~~~ ~~~~~~~~~( 8161 ~~~)~~~~~~ ~|~~~~~~(~ ~~~~~~~~~~ ~~~~~~~~~~ )~~~~~~~|~ |~|~~~~~|< 8221 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8281 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8341 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~>~~~~~~~~ 8401 ~~~|~~~~~~ ~~~~~~<~~~ ~~~~~~~~(~ ~~~~~~)~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8461 ~~(~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8521 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8581 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8641 ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8701 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~|~~ (~|~~~~~)~ ~~~~~~~~~~ 8761 ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 8821 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~(~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ 8881 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~(~~~~~~ ~~~~~~~~~~ 8941 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~)~~|~~~~ 9001 ~~~~~~~~~~ |~~~~~~~~~ ~~~~~~|~~~ ~|~~~~~~~~ |~~~~~~~~~ ~~~~~~~~~~ 9061 ~~(~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~|~|~~~~~| 9121 ~~~~~~~~~~ ~~~~~(~~~~ ~~~)~~~~~~ ~~~~~~~~|~ ~~~~(~~~~~ )~~~~~~~~~ 9181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~|~~~~(~~ ~~)~~~~~~~ ~~~~~~~~~~ 9241 ~~|~~~~~~~ ~~|~|<~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9301 >~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~(~~~~~ ~~(~~~~~)~ ~~~~~)~~~~ 9361 ~~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.L.lacca 10775 bp RNA RNA 21-JUL-1998 DEFINITION Mitochondrion Laccaria laccata.; . ACCESSION AF006486 KEYWORDS . SOURCE Mitochondrion Laccaria laccata. ORGANISM Mitochondrion Laccaria laccata. REFERENCE 1 (bases 1 to 538) AUTHORS Selosse,M.A., Martin,F. and Le Tacon,F. TITLE ectomycorrhizal basidiomycete Laccaria bicolor in forest plantations Does introduced mitochondrial genome persist independantly of co-introduced nuclear genomes? The case of the JOURNAL Symbiosis (1997) In press STANDARD No information REFERENCE 2 (bases 1 to 1830) AUTHORS Selosse,M.A., Martin,F. and Le Tacon,F. TITLE Survival of an introduced ectomycorrhizal Laccaria bicolor strain in an European forest plantation confirmed by mitochondrial analysis JOURNAL New Phytol. (1998) In press STANDARD No information REFERENCE 3 (bases 1 to 538) AUTHORS Selosse,M.A., Martin,F. and Le Tacon,F. TITLE Direct Submission JOURNAL Submitted (02-JUN-1997) Forest Microbiology, INRA, Centre de Recherche de Nancy, Champenoux, 54 54280, France STANDARD No information REFERENCE 4 (bases 1 to 1830) AUTHORS Selosse,M.A., Martin,F. and Le Tacon,F. TITLE Direct Submission JOURNAL Submitted (21-JUL-1998) Forest Microbiology, INRA, Centre de Recherche de Nancy, Champenoux, 54 54280, France STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: AF006486 BASE COUNT 657 a 263 c 343 g 567 t 8945 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 301 |~~~~~~~~| ~~~~~~~~~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~(~~~~ 361 ~~~~~~~~~) ~|~~~~~~~~ ~~~~~~~|~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ 421 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~(~~~~ 481 )~~~|~~~~~ ~~(~~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~)~ 541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~<~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 601 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 661 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ |~~~~~~~~~ 841 ~~~(~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~(~~~ ~~)~~~~~~~ |~~~~~~~~~ ~~~~~~~(~~ ~~~~)~~~~~ ~~~~~~~~~~ 961 ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~>~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~< ~~~~~~~~~~ ~~~~~~~~~~ 1261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~)~~ ~~~~~~~~~~ ~~~|~(~~~) 1321 ~~~~~~~(~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ 1381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ >~~~~~~~~~ ~~~~~~(~~~ ~~~~~~~~~~ 1561 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~)~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~>~~~~ ~~~~~~~~~~ ~~~~~~~~<~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~~~~ 2041 ~~)~~~~~~~ ~~~~~~~~~~ ~~~~~~(~~~ ~~~~~)~~~~ |~~~~~~~~~ ~~~~~~~~~~ 2101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2221 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2281 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2341 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2401 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2461 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ 2521 ~~~~(~~~~~ )~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2581 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2641 ~~~~~~~~~~ ~~~~~>~~~~ ~~(~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2701 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2761 ~(~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~) ~~~~~~~~~~ 2821 ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2881 ~~(~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2941 (~uuga)ugu cu-ac----- ----<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- --aauaauau aaaaaca>ga AAU|-UUAUG 3061 G|AGGUAC|A GCAaggc-aa uu-ccc---- ---------- ---------< aacaaauuua 3121 aggu-----a aaacaaaaau ucuuuuuuug uuuuauauuu uuauuauuau uuuuauaauu 3181 auaaaaauuc uauuuauaag auaaaauaau uuauaucaaa uuaacagacu caauaaguag 3241 ccuuaucugc guucagguug cggggaucua gacaaucuua ccuu>----- --------ug 3301 gaa---g-cg aauCUCGG-- AAUU|-ACAU -A-A---AUU ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -gau--GG-U -AGAU-AUUC AGACU--GC- UC-AU(-GCU 3481 AAG)UUGGGC AG-UC----A AGACGG(AAA -CAG)CCG-A GAACA-C-UG -AU-CAA--- 3541 --GGU-CCCA -AAU-GA-U- UGUUAAGUG- --------AA AUUAAGGAC- GUAGCAAUAU 3601 cga------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AUACA-GCUG U<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAAGU-G AGC(CUGGCA 3781 GU-C)-GCUA --CUU|A(U- AA)U|GAUCG U(auguaaca )AC|-GCAU- CAGCAGuag-au-a -gu-aGC|-G CCGAAAAU-- ---------- ---------- ----UUAACG 3961 GGUCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---uAAACAA UCA------- ---------- ---------- ---------- 4081 -------|AC CGAU--AUC| G--U-GU|U- gguuaauaau aa-------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 aaau--)uug uuauuaauCU -A-----GGU AGUAG-AA|- CA-UUCAGUA aaacuuuaaa 4501 u--------- cgaau-agug (uuu----)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->ca uua--uuuug u|agga---| UACUGAAGAG AGAAUGC-UG 4681 AC|AUGAGUA -ACGU-AAAa aga-ag-u-- (uauaau--- ---------- ---------- 4741 ---------- -----)---a cuucu-|CGC C-GAAU-ACG AAA--GGGUu -|gcaaauag 4801 g-aaa---gg <--------- --->(--uua au)c-c|-gu uuuguu---- ---------- 4861 ---uuaaug- -CGGCCUCUA A-G-g-g--- auguagc(-u aaa------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-gcua---- cu---a-cuG AU-GAGuc-- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- -ACCGUA|CC 6481 C--UAAACC- -(GACACA)G G|UUCGU-AG GUA-(GAG-A A-----)-UA CUAAGGCG-| 6541 |--UAGAG-C U--AAAAGUU -GUUA-AGGA ACUCGGCAAG AUCUCC-UCC UAAG(UUUGA 6601 )CGACAA-GA GGG|------ ---------- -----(---- ---)------ ---------- 6781 ----|G(ACA )C--AAAAUC GGAGGCCA|C GA---CUG-U UU(ACUAA)A AA-CACA-AC 6841 ACAGUG|CA- -AUCAU---- ---------- (--UAAU--- ------)--- ---------- 6901 AUGAUAGUA- UAC-UGUGUG AAAUUU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-AU|G CCAUUA-AUA UAAGAG-CGa 7021 --UCAUGG-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------u uuu)----CU GUGA-uUAAU C-GAAAAU-| 7141 CU-GGUU-AA U-|AG-C|-G -GUCUU-(AA CUAUG)AGGA UC|C(UAA)- GG-UAGCAAA 7201 AUA-AA-U-U |GGCCUU(-U AAAU-)GAGG UC|CG-GUAU CAAUAAUGUA A-CGAUGGUC 7261 UC-------- ---------- -------ACU GUCUCUACAA CUUG-CU-CA ----GUGAAA 7321 UU|G|AAUUA CG-CG(U-GC AGAUG)CGCG UUG----CCU UCAGGGGGAC GGGAAG-ACC 7381 CUAUGC-|-A GCUUC-UACU GU|--A-GUU AGU--UAUC| augaa- ucuagaacaa -ucaaaauu- aau---AGUG 7501 AAUAGGGAA- -GUC------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----gau a)-------- -------gac 7681 aaauagugga aaccuua|aa ----auucu- g-a-u-uggg uuua-uguuu acc--uu-aa 7741 auuu-(--aa uaaa)-aaa- ---------- ---------- ---------- ---a--gg<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->GAGA GUUUA-C-UA -AUU-GG-CA GUUUGACUG( 8161 GGG)CG-GU- C|GUCUUU(- --------AA UAGAGUAGC- )AAAGUAC|A |U|CCaa-|< 8221 auauuucauu uaaaacuaaa aauuuauugu uuuauaaauu uuauuacaaa aaacuuuauu 8281 uuauuuuagu auaauuuaaa guaauaauua auuuuaauua auuaacauuc uaaauuuuuc 8341 uuucuaauca uuaauuuuau a--------- ---------- ---------- ->A-GG-UAU 8401 AGC|--UA-- ------<--- gaaauuga(a uggaga)uca au-------- -------caa 8461 cc(aguga-a g)gguugcgc a--------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -----GA|GU (U|CAAUG)G CGAUAAG-CA 8761 U-GC-UUAAC UGAAA-GAC( -cuaaaa--- )GUCGC-ACA G--------- ---------- 8821 ---------- --------AU AC-------- ---(GUAA-- -)-------- ----GUA-GG 8881 G|---CAUAG UGACC-CCUC GC-U------ ---------- AUA(------ ---------- 8941 ---------- ---------- ---------- ---------- ----AUAUGG GA)UA|GACG 9001 GGGAUCAAU- |UGAUAAAAG UUACGC|UAG G|GAUAA~~~ |~~~~~~~~~ ~~~~~~~~~~ 9061 ~~(~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~|~|~~~~~| 9121 ~~~~~~~~~~ ~~~~~(~~~~ ~~~)~~~~~~ ~~~~~~~~|~ ~~~~(~~~~~ )~~~~~~~~~ 9181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~|~~~~(~~ ~~)~~~~~~~ ~~~~~~~~~~ 9241 ~~|~~~~~~~ ~~|~|<~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9301 >~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~(~~~~~ ~~(~~~~~)~ ~~~~~)~~~~ 9361 ~~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.L.bic.1 10775 bp RNA RNA 04-AUG-1998 DEFINITION Mitochondrion Laccaria bicolor.; . ACCESSION AF079306 KEYWORDS . SOURCE Mitochondrion Laccaria bicolor. ORGANISM Mitochondrion Laccaria bicolor. REFERENCE 1 (bases 1 to 1839) AUTHORS Selosse,M.A., Martin,F. and Le Tacon,F. TITLE Survival of an introduced ectomycorrhizal Laccaria bicolor strain in an European forest plantation confirmed by mitochondrial analysis JOURNAL New Phytol. (1998) In press STANDARD No information REFERENCE 2 (bases 1 to 1839) AUTHORS Selosse,M.A., Martin,F. and Le Tacon,F. TITLE Direct Submission JOURNAL Submitted (20-JUL-1998) Microbiologie Forestiere, INRA, Foret d'Amance, Champenoux 54280, France STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: AF079306 BASE COUNT 663 a 264 c 344 g 568 t 8936 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 301 |~~~~~~~~| ~~~~~~~~~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~(~~~~ 361 ~~~~~~~~~) ~|~~~~~~~~ ~~~~~~~|~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ 421 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~(~~~~ 481 )~~~|~~~~~ ~~(~~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~)~ 541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~<~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 601 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 661 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ |~~~~~~~~~ 841 ~~~(~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~(~~~ ~~)~~~~~~~ |~~~~~~~~~ ~~~~~~~(~~ ~~~~)~~~~~ ~~~~~~~~~~ 961 ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~>~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~< ~~~~~~~~~~ ~~~~~~~~~~ 1261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~)~~ ~~~~~~~~~~ ~~~|~(~~~) 1321 ~~~~~~~(~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ 1381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ >~~~~~~~~~ ~~~~~~(~~~ ~~~~~~~~~~ 1561 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~)~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~>~~~~ ~~~~~~~~~~ ~~~~~~~~<~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~~~~ 2041 ~~)~~~~~~~ ~~~~~~~~~~ ~~~~~~(~~~ ~~~~~)~~~~ |~~~~~~~~~ ~~~~~~~~~~ 2101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2221 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2281 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2341 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2401 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2461 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ 2521 ~~~~(~~~~~ )~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2581 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2641 ~~~~~~~~~~ ~~~~~>~~~~ ~~(~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2701 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2761 ~(~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~) ~~~~~~~~~~ 2821 ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2881 ~~(~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2941 (~uuga)ugu cu-ac----- ----<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- -aaauaauau aaaaaca>ga AAU|-UUAUG 3061 G|AGGUAC|A GCAaggc-aa uu-ccc---- ---------- ---------< aacaaauuua 3121 aggu-----a aaacaaaaau ucuuuucuug uuuuauauuu uuauuauuau uuuuauaaua 3181 auaaaaauuc uauuuauaag auaaaauaau uuauauuaaa uuaacagaca caauaaguag 3241 ccuuaucugc guucagguug cggggaucua gaaaaucuua ccuu>----- --------ug 3301 gaa---g-cg aauCUCGG-- AAUU|-ACAU -A-A---AUU ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -gau--GG-U -AGAU-AUUC AGACU--GC- UC-AU(-GCU 3481 AAG)UUGGGC AG-UC----A AGACGG(AAA -CAG)CCG-A GAACA-C-UG -AU-CAA--- 3541 --GGU-CCCA -AAU-GA-U- UGUUAAGUG- --------AA AUUAAGGAC- GUAGCAaUAU 3601 cga------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AUACA-GCUG U<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAAGU-G AGC(CUGGCA 3781 GU-C)-GCUA --CUU|A(U- AA)U|GAUCG U(auguaaca )AC|-GCAU- CAGCAGuag-au-a -gu-aGC|-G CCGAAAAU-- ---------- ---------- ----UUAACG 3961 GGUCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---uAAACAA UCA------- ---------- ---------- ---------- 4081 -------|AC CGAU--AUC| G--U-GU|U- gguuaauaau aa-------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 aaau--)uug uuauuaauCU -A-----GGU AGUAG-AA|- CA-UUCAGUA aaacuuuaaa 4501 u--------- caaau-agug (uuu----)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->ca uua--uuuug u|agga---| UACUGAAGAG AGAAUGC-UG 4681 AC|AUGAGUA -ACGU-AAAa aga-ag-u-- (uauaau--- ---------- ---------- 4741 ---------- -----)---a cuucu-|CGC C-GAAU-ACG AAA--GGGUu -|gcaaauag 4801 g-aaa---gg <--------- --->(--uua au)c-c|-gu uuuguu---- ---------- 4861 ---uuaaug- -CGGCCUCUA A-G-g-g--- auguagc(-u aaa------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-gcua---- cu---a-cuG AU-GAGuc-- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- -ACCGUA|CC 6481 C--UAAACC- -(GACACA)G G|UUCGU-AG GUA-(GAG-A A-----)-UA CUAAGGCG-| 6541 |--UAGAG-C U--AAAAGUU -GUUA-AGGA ACUCGGCAAG AUCUCC-UCC UAAG(UUUGA 6601 )CGACAA-GA GGG|------ ---------- -----(---- ---)------ ---------- 6781 ----|G(ACA )C--AAAAUC GGAGGCCA|C GA---CUG-U UU(ACUAA)A AA-CACA-AC 6841 ACAGUG|CA- -AUCAU---- ---------- (--UAAU--- ------)--- ---------- 6901 AUGAUAGUA- UAC-UGUGUG AAAUUU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-AU|G CCAUUA-AUA UAAGAG-CGa 7021 --UCAUGG-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------u uuu)----CU GUGA-uUAAU C-GAAAAU-| 7141 CU-GGUU-AA U-|AG-C|-G -GUCUU-(AA CUAUG)AGGA UC|C(UAA)- GG-UAGCAAA 7201 AUA-AA-U-U |GGCCUU(-U AAAU-)GAGG UC|CG-GUAU CAAUAAUGUA A-CGAUGGUC 7261 UC-------- ---------- -------ACU GUCUCUACAA CUUG-CU-CA ----GUGAAA 7321 UU|G|AAUUA CG-CG(U-GC AGAUG)CGCG UUG----CCU UCAGGGGGAC GGGAAG-ACC 7381 CUAUGC-|-A GCUUC-UACU GU|--A-GUU AGU--UAUC| auaaa- ucuagaacaa -ucaaaauu- aau---AGUG 7501 AAUAGGUAA- -GUC------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----gau a)-------- -------gac 7681 aaauagugga aaccuua|aa ----auucu- g-a-u-uggg uuua-uguuu acc--uu-aa 7741 auuu-(--aa uaaa)-aaa- ---------- ---------- ---------- ---a--gg<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->GAUA GUUUA-C-UA -AUU-GG-CA GUUUGACUG( 8161 GGG)CG-GU- C|GUCUUU(- --------AA UAGAGUAGC- )AAAGUAC|A |U|CCaa-|< 8221 auauuucauu uaaaacuaaa aauuuauugu uuuauaaauu uuauuacaaa aaac-----u 8281 uuauuuuagu auaauuuaaa guaauaauua auuuuaauua auuaacauuc uaaauuuuuc 8341 uuucuaauca uuaauuuuau a--------- ---------- ---------- ->A-GG-UAU 8401 AGC|--UA-- ------<--- gaaauuga(a uggaga)uca au-------- -------caa 8461 cc(aguga-a g)gguugcgc a--------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -----GA|GU (U|CAAUG)G CGAUAAG-CA 8761 U-GC-UUAAC UGAAA-GAC( -cuaaaa--- )GUCGC-ACA G--------- ---------- 8821 ---------- --------AU AC-------- ---(GUAA-- -)-------- ----GUA-GG 8881 G|---CAUAG UGACC-CCUC GC-U------ ---------- AUA(------ ---------- 8941 ---------- ---------- ---------- ---------- ----AUAUGG GA)UA|GACG 9001 GGGAUCAAU- |UGAUAAAAG UUACGC|UAG G|GAUAA~~~ |~~~~~~~~~ ~~~~~~~~~~ 9061 ~~(~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~|~|~~~~~| 9121 ~~~~~~~~~~ ~~~~~(~~~~ ~~~)~~~~~~ ~~~~~~~~|~ ~~~~(~~~~~ )~~~~~~~~~ 9181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~|~~~~(~~ ~~)~~~~~~~ ~~~~~~~~~~ 9241 ~~|~~~~~~~ ~~|~|<~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9301 >~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~(~~~~~ ~~(~~~~~)~ ~~~~~)~~~~ 9361 ~~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.L.bic.2 10775 bp RNA RNA 21-JUL-1998 DEFINITION Mitochondrion Laccaria bicolor.; . ACCESSION AF006485 KEYWORDS . SOURCE Mitochondrion Laccaria bicolor. ORGANISM Mitochondrion Laccaria bicolor. REFERENCE 1 (bases 1 to 533) AUTHORS Selosse,M.A., Martin,F. and Le Tacon,F. TITLE plantations Does introduced mitochondrial genome persist independantly of co-introduced nuclear genomes? The case of the ectomycorrhizal basidiomycete Laccaria bicolor in forest JOURNAL Symbiosis (1997) In press STANDARD No information REFERENCE 2 (bases 1 to 1839) AUTHORS Selosse,M.A., Martin,F. and Le Tacon,F. TITLE Survival of an introduced ectomycorrhizal Laccaria bicolor strain in an European forest plantation confirmed by mitochondrial analysis JOURNAL New Phytol. (1998) In press STANDARD No information REFERENCE 3 (bases 1 to 533) AUTHORS Selosse,M.A., Martin,F. and Le Tacon,F. TITLE Direct Submission JOURNAL Submitted (02-JUN-1997) Forest Microbiology, INRA, Centre de Recherche de Nancy, Champenoux, 54 54280, France STANDARD No information REFERENCE 4 (bases 1 to 1839) AUTHORS Selosse,M.A., Martin,F. and Le Tacon,F. TITLE Direct Submission JOURNAL Submitted (21-JUL-1998) Forest Microbiology, INRA, Centre de Recherche de Nancy, Champenoux, 54 54280, France STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: AF006485 BASE COUNT 662 a 267 c 345 g 565 t 8936 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 301 |~~~~~~~~| ~~~~~~~~~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~(~~~~ 361 ~~~~~~~~~) ~|~~~~~~~~ ~~~~~~~|~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ 421 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~(~~~~ 481 )~~~|~~~~~ ~~(~~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~)~ 541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~<~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 601 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 661 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ |~~~~~~~~~ 841 ~~~(~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 901 ~~~~~~(~~~ ~~)~~~~~~~ |~~~~~~~~~ ~~~~~~~(~~ ~~~~)~~~~~ ~~~~~~~~~~ 961 ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1021 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1141 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~>~~~~~~ 1201 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~< ~~~~~~~~~~ ~~~~~~~~~~ 1261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~)~~ ~~~~~~~~~~ ~~~|~(~~~) 1321 ~~~~~~~(~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ 1381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ >~~~~~~~~~ ~~~~~~(~~~ ~~~~~~~~~~ 1561 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ 1621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~)~~~ ~~~~~~~~~~ 1681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1801 ~~~~~~~~~~ ~~~~~~~~~~ ~~<~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1861 ~~~~~>~~~~ ~~~~~~~~~~ ~~~~~~~~<~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1921 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 1981 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> (~~~~~~~~~ 2041 ~~)~~~~~~~ ~~~~~~~~~~ ~~~~~~(~~~ ~~~~~)~~~~ |~~~~~~~~~ ~~~~~~~~~~ 2101 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2161 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2221 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2281 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2341 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2401 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2461 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ 2521 ~~~~(~~~~~ )~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2581 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2641 ~~~~~~~~~~ ~~~~~>~~~~ ~~(~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2701 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2761 ~(~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~) ~~~~~~~~~~ 2821 ~~~~~~~~~~ ~~~~~~~~~( ~~~~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2881 ~~(~~~~~~) ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 2941 (~uuga)ugu cu-ac----- ----<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- -aaauaauau aaaaaca>ga AAU|-UUAUG 3061 G|AGGUAC|A GCAaggc-aa uu-ccc---- ---------- ---------< aacaaauuua 3121 aggu-----a aaacaaaaau ucuuuucuug uuuuauauuu uuauuauuau uuuuauaaua 3181 auaaaaauuc uauuuauaag auaaaauaau uuauauuaaa uuaacagaca caauaaguag 3241 ccuuaucugc guucagguug cggggaucua gaaaaucuua ccuu>----- --------ug 3301 gaa---g-cg aauCUCGG-- AAUU|-ACAU -A-A---AUU ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -gau--GG-U -AGAU-AUUC AGACU--GC- UC-AU(-GCU 3481 AAG)UUGGGC AG-UC----A AGACGG(AAA -CAG)CCG-A GAACA-C-UG -AU-CAA--- 3541 --GGU-CCCA -AAU-GA-U- UGUUAAGUG- --------AA AUUAAGGAC- GUAGCAAUAU 3601 cga------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- AUACA-GCUG U<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->GAAGU-G AGC(CUGGCA 3781 GU-C)-GCUA --CUU|A(U- AA)U|GAUCG U(auguaaca )AC|-GCAU- CAGCAGuag-au-a -gu-aGC|-G CCGAAAAU-- ---------- ---------- ----UUAACG 3961 GGUCU----- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---uAAACAA UCA------- ---------- ---------- ---------- 4081 -------|AC CGAU--AUC| G--U-GU|U- gguuaauaau aa-------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(u 4441 aaau--)uug uuauuaauCU -A-----GGU AGUAG-AA|- CA-UUCAGUA aaacuuuaaa 4501 u--------- caaau-agug (uuu----)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->ca uua--uuuug u|agga---| UACUGAAGAG AGAAUGC-UG 4681 AC|AUGAGUA -ACGU-AAAa aga-ag-u-- (uauaau--- ---------- ---------- 4741 ---------- -----)---a cuucu-|CGC C-GAAU-ACG AAA--GGGUu -|gcaaauag 4801 g-aaa---gg <--------- --->(--uua au)c-c|-gu uuuguu---- ---------- 4861 ---uuaaug- -CGGCCUCUA A-G-g-g--- auguagc(-u aaa------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >-gcua---- cu---a-cuG AU-GAGuc-- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ------ ---------- ---------- -ACCGUA|CC 6481 C--UAAACC- -(GACACA)G G|UUCGU-AG GUA-(GAG-A A-----)-UA CUAAGGCG-| 6541 |--UAGAG-C U--AAAAGUU -GUUA-AGGA ACUCGGCAAG AUCUCC-UCC UAAG(UUUGA 6601 )CGACAA-GA GGG|------ ---------- -----(---- ---)------ ---------- 6781 ----|G(ACA )C--AAAAUC GGAGGCCA|C GA---CUG-U UU(ACUAA)A AA-CACA-AC 6841 ACAGUG|CA- -AUCAU---- ---------- (--UAAU--- ------)--- ---------- 6901 AUGAUAGUA- UAC-UGUGUG AAAUUU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-AU|G CCAUUA-AUA UAAGAG-CGa 7021 --UCAUGG-- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------u uuu)----CU GUGA-uUAAU C-GAAAAU-| 7141 CU-GGUU-AA U-|AG-C|-G -GUCUU-(AA CUAUG)AGGA UC|C(UAA)- GG-UAGCAAA 7201 AUA-AA-U-U |GGCCUU(-U AAAU-)GAGG UC|CG-GUAU CAAUAAUGUA A-CGAUGGUC 7261 UC-------- ---------- -------ACU GUCUCUACAA CUUG-CU-CA ----GUGAAA 7321 UU|G|AAUUA CG-CG(U-GC AGAUG)CGCG UUG----CCU UCAGGGGGAC GGGAAG-ACC 7381 CUAUGC-|-A GCUUC-UACU GU|--A-GUU AGU--UAUC| auaaa- ucuagaacaa -ucaaaauu- aau---AGUG 7501 AAUAGGUAA- -GUC------ ---------- --<------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(----gau a)-------- -------gac 7681 aaauagugga aaccuua|aa ----auucu- g-a-u-uggg uuua-uguuu acc--uu-aa 7741 auuu-(--aa uaaa)-aaa- ---------- ---------- ---------- ---a--gg<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->GAUA GUUUA-C-UA -AUU-GG-CA GUUUGACUG( 8161 GGG)CG-GU- C|GUCUUU(- --------AA UAGAGUAGC- )AAAGUAC|A |U|CCaa-|< 8221 auauuucauu uaaaacuaaa aauuuauugu uuuauaaauu uuauuacaaa aaac-----u 8281 uuauuuuagu auaauuuaaa guaauaauua auuuuaauua auuaacauuc uaaauuuuuc 8341 uuucuaauca uuaauuuuau a--------- ---------- ---------- ->A-GG-UAU 8401 AGC|--UA-- ------<--- gaaauuga(a uggaga)uca au-------- -------caa 8461 cc(aguga-a g)gguugcgc a--------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -----GA|GU (U|CAAUG)G CGAUAAG-CA 8761 U-GC-UUAAC UGAAA-GAC( -cuaaaa--- )GUCGC-ACA G--------- ---------- 8821 ---------- --------AU AC-------- ---(GUAA-- -)-------- ----GUA-GG 8881 G|---CAUAG UGACC-CCUC GC-U------ ---------- AUA(------ ---------- 8941 ---------- ---------- ---------- ---------- ----AUAUGG GA)UA|GACG 9001 GGGAUCAAU- |UGAUAAAAG UUACGC|UAG G|GAUAA~~~ |~~~~~~~~~ ~~~~~~~~~~ 9061 ~~(~~~~~~~ )~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~|~~~~~ ~|~|~~~~~| 9121 ~~~~~~~~~~ ~~~~~(~~~~ ~~~)~~~~~~ ~~~~~~~~|~ ~~~~(~~~~~ )~~~~~~~~~ 9181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~|~~~~(~~ ~~)~~~~~~~ ~~~~~~~~~~ 9241 ~~|~~~~~~~ ~~|~|<~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9301 >~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~(~~~~~ ~~(~~~~~)~ ~~~~~)~~~~ 9361 ~~~~~~<~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~>~ ~~~~~~~~~~ ~~~~~~~~~~ 9421 ~|~~~~~~~~ (~~~~~)<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9481 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~> 9541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.A.macro 10775 bp RNA RNA 27-MAR-1996 DEFINITION Mitochondria Allomyces macrogynus; . ACCESSION U41288 KEYWORDS . SOURCE Mitochondria Allomyces macrogynus. ORGANISM Mitochondria Allomyces macrogynus. REFERENCE 1 (bases 20975 to 22690) AUTHORS Paquin,B., Laforest,M.J. and Lang,B.F. TITLE Interspecific transfer of mitochondrial genes in fungi and JOURNAL Proc. Natl. Acad. Sci. U.S.A. 91 (25), 11807-11810 (1994) STANDARD No information REFERENCE 2 (bases 15012 to 19727) AUTHORS Paquin,B., Roewer,I., Wang,Z. and Lang,B.F. TITLE A robust fungal phylogeny using the mitochondrially encoded nad5 protein sequence JOURNAL Can. J. Bot. 73, S180-S185 (1995) STANDARD No information REFERENCE 3 (bases 20975 to 22690) AUTHORS Paquin,B., O'Kelly,C.J. and Lang,B.F. TITLE Intron-encoded open reading frame of the GIY-YIG subclass in a plastid gene JOURNAL Curr. Genet. 28 (1), 97-99 (1995) STANDARD No information REFERENCE 4 (bases 30388 to 40110) AUTHORS Paquin,B., Forget,L., Roewer,I. and Lang,B.F. TITLE Molecular phylogeny of Allomyces macrogynus: congruency between nuclear ribosomal RNA- and mitochondrial protein-based trees JOURNAL J. Mol. Evol. 41 (5), 657-665 (1995) STANDARD No information REFERENCE 5 (bases 1 to 57473) AUTHORS Paquin,B. and Lang,B.F. TITLE The mitochondrial DNA of Allomyces macrogynus: the complete genomic sequence from an ancestral fungus JOURNAL J. Mol. Biol. 255 (5), 688-701 (1996) STANDARD No information REFERENCE 6 (bases 1 to 57473) AUTHORS Paquin,B., Laforest,M-J. and Lang,B.F. TITLE 80 conserved, palindromic sequence elements in the mitochondrial DNA of Allomyces sp.: Evidence for mobility JOURNAL Unpublished STANDARD No information REFERENCE 7 (bases 1 to 57473) AUTHORS Lang,B.F. TITLE Direct Submission JOURNAL Submitted (24-NOV-1995) Franz Lang, Departement de Biochimie, Universite de Montreal, 2900 Edouard-Montpetit, Montreal, Quebec H3T 1J4, Canada STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: U41288 Allomyces macrogynus (chytridiomycete) mitochondrial LSU rRNA B. Paquin & B.F. Lang, J. Mol. Biol., in press Gray January 1996 NCBI gi: 1236403 BASE COUNT 1017 a 542 c 754 g 849 t 7613 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ aacauacc-a agga------ ---------- ---------- ---------- 241 ---------- ---------- ---------- ----gUAAAG GACUAAUUG- ----AGGAUG 301 |ACU--AGU| CAU-UCUA-U A|au------ ---------- -----UGGA| -agca(-cga 361 auga-----) g|gcu-aaa- aGAAUGA|u- --agu----- ---------- ---------- 421 ---------- ---au----g UUGUUCG-AU UCCAA-A-GG U--------- -----(GAAA 481 )ACC|----- ---------- ---------- aaaga----- ---------- (cggag-aau 541 )--------- -----ucuu- ---<----au ggaguccugu cuauuu---- ---------- 601 ---------- ---------- ---------- ---------- ---------- ---------- 661 ---------- ---------- ---------- ---------- ---------- ---------- 721 ---------- ---------- ---------- ---------- ---------- ---------- 781 ---------- ---------- ---------- -------->- --uuauUAAC |CCUGUGAAU 841 UGA(AACA)U CUUAGUA--- -ACAGG---- ---------- ---------- ---AGGAAAA 901 GAAAUC(-AA CC)GA-G-AU |UUUaACGA- -GUAG-U(-G GCGA)GCGAA -AGUAAAug- 961 -AAaaca<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------u 1081 ucauguuuug auccgaaaua ucuuaucgau guuucgauuu uuucaaagac cccguaccgg 1141 gucuuggggc augucugaaa uugaacauca cacacuuacc caugauaaag gagaugguuu 1201 ggaucuucga uucuaccauu uucaggcagu g--uguuua< u--------- ---------- 1261 ---------- ---------- ---------> (ggaa--)ug ggug------ GC-|C(AAA) 1321 G--AAGG(UG AAAGU)CCUg ua--aauuuc aguaguagac cacuuaugg- ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- ----AGUAGA ACGA--(--- ---------- 1561 ----auu)-- UUGUUCAGAA ---gaaAGGG G(UACCA-U) -CCUCUAaua aaUUA-AAUA 1621 ---UGAUAGA A-UGAACGAU AGUG-AA--- --GAGUACC( -GUGA-)GGG ---AAA-GU- 1681 UG-------- ----aaaagu a------ccu cu-------- ---------- aaga------ 1741 GAACGAAGCC U(-uccg--) AGGCuucgaa uaucaaugcc ggagg-GGUG AA--AUAGA- 1801 UCCUG-AAUC AGUUaAGU-C U-<------- ---------- ---------- ---------- 1861 ----->AAAA GCAGUUUGAG CCA-----<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (---agauua 2041 --)-----UG GUGAAGAC-G UACCUU(UU- GCAUA)AUGG |GUC-AGCAA GU-----UA- 2101 AUUUUUGGAG CAAg-agaac aaaagaacgu auc------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- -------uuu gguacguugg u-gauc-u-a 2521 agu-(-gaaa )--ac-aaaa gaacaaagug agacuuaguc uuaccccuau acauaauuuu 2581 gc-------- ---------- ---------- ---------- ---------- ---------- 2641 ------acuc agugugauug augaucuggg ug-uucu--- gu----gaaG UUCCA-GAAA 2701 UUA-GACCCG AA-ACCAA-G UG-AUCUAUC CAU-GGC-CA GGU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----guaag) ---------- 2821 --ACCGAA-C GG-GUGAUC( GUAGUAA-U) GCUC-UCCGA --UGAGCUU- UGGAUAG-cC 2881 GU(G-AAAU) GCG-AAUC-G A-ACUUGGAA AUAGCU-GGU AUACC--GCG AA-AAC-UAU 2941 (-UGAA)GUA GA-AC-GCUA AACC<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->-- uac|-AAACG 3061 A|GGGUAC|A GCACUGG--A A--------- --------(g aaaa----)< ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ----UU--CU AAACUGGA-- AAUA|-UCGU -U-G---acu ucauaugagu ccugagaccc 3361 cccuccgggg ggguuuacau uuu------- ---------- ---------- ---------- 3421 ---------- ---------- -uag--GU-U -UAGU-AGUC AGAUU--AU- CU-GU(-GAU 3481 AAG)GUAGUU AA-UC----A AAAGGG(AAA -CAG)CCC-A GACCA-A-AA -GU-UAA--- 3541 --GGU-CUCA -AAU-GA-U- UACUAAGUG- --------aa auuaaCCG-- Aaaacaaag| 3601 cgacaagccc gaaaaaaauc acauagauau auaucuucau guggguagag ggaaaugaug 3661 guuuuacuau caugagucg| AGACA-AUCA C<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->uUUGU-G GGC(UUGGAA 3781 GC-A)-GCCA -UCAA|U(U- AG)A|GAAAG C(--GUUACA )GC|-UCAA- UGAUCGAUU-UU-G -UU-UCU|-C GGGAAAAU-- ---------- ---------- ----GUAUCG 3961 GGUCAgacuc uuaucggccu caguaaccga auugaaaaga guugggggua uaccuuuggu 4021 ggcucugccc cuuuAAGUAA UCA------- ---------- ---------- ---------- 4081 -------|AC CGAA--ACU| U--U-GG|ca agcaugaugu gagacauggu aacgugacuu 4141 au-------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------c auuaugu-uu -g-----GGU AGCGG-UA|- CA-UUCAAUu g--auggagu 4501 g--------a aGGGA-AAAC (gaga---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->GU UUU--UCU-G G|aaugg--| AUUUGAAGAG AGAAUGC-UG 4681 AC|AUGAGUA -ACUA-AAA- agg-a----- (aaaaaaa-- ---------- ---------- 4741 ---------- -----)---- -uccuu|CCC C-UAAA-AUU CAA--GGGUA -|----aaaa 4801 a--------- ---------- ----(----- --)---|--- ---------- ---------- 4861 ----uaau-- -CGGUUUCUA A-G-U-C--- gagACA-(-C AAC------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--UGU-g-u uu---G-ACG AU-GAAGAgg aacgaa(--- ---------- ---------- 5041 ---------u cugau----- -)uucguucu |g----|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---|------ ---------- ---------- ---------- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ---<------ 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---------a uuuaua---- -ACCGUA|CC 6481 -----UUCC- -(AACGCU)G G|AGAAU-GA GCUG(GUA-A A-----)CAG UGAAGGGGA| 6541 |--AUGGG-A G--AACCAUC -UUGA-AGGA ACUAGGCAAA AUGACU-CUG UAAC(UUCG- 6601 )GGAGAA-GG AGG|agaaga augaaaguga c----(--au ug)------- ---------- 6661 ---------- ---------- ---------- ---------- -gucauu[ga aagagaagau 6721 ac(uuc)gua ucuu|gucca aacccc(g-- ---------- --uu)ggggu uucgau]uuc 6781 uucu|-(--a )aa-aaaaUA GAGAGGGG|C AA---CUG-U UU(ACUAA)A AA-CACA-GG 6841 AGUCAG|CA- -ACCCC---- ---------- (--GUAA--- ------)--- ---------- 6901 GGGUUAGUA- UUG-GCUCUG AAGUCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G UC-CG-GU|G CAAGUA-AGU GAAagauga- 7021 --aagaa--- (ag[agauga aggaccccgg ccc(gaa)gg gccgggggac uugauccaaa 7081 aaguccgccc c(uuc)gggg cguuccuuuu u]cga)---u uuuu--uucu cauaacCU-| 7141 CU-UGUA-AA C-|GA-C|-G -GCCUU-(AA CCAUA)AGGG UC|C(UAA)- GG-UAGCGAA 7201 AUU-CC-U-A |GGCUAA(-U AAUU-)GUAG UC|CU-GCAU GAAUGGCGUA A-UGAUCCCU 7261 CU-------- ---------- -------ACU UUCUACAAGA UGGA-CC-CA ----GUGAAA 7321 UU|G|AAUUA UC-CG(U-GC AGAUG)CGGA UUA----CCA UUAGCCAGAC GAGAAG-ACC 7381 CUAUGA-|-A GCUUU--ACU GG|--A-AUU AAA--CUUU| <--------- ---------- 7441 ---------- ---------- --->guuuc- gu-----ugg -ugaacug-- ---------- 7501 ---------- ---------- ---------- ---------- ---------- ---------- 7561 ---------- ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------- --------aa u--------- -------gua 7681 aaacuugguc uuuuucu|u- -----cauu- c-a-c-cgau aaua-c---- ---------- 7741 -ggaa(-auu aug-)uucc- ---------- ---------- ---------- ---------- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- --------uu uaAGU-U-UA -AGU-GA-CA GUUUAACUG( 8161 GGG)AG-GU- U|UCCUGC(- --------UA AAUAGUAAC- )GAAG-GA|G |U|ACAA-|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->A-GG-UAU 8401 -AA|--uug- AAGUCA<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (cucuguaau )----UGACU UG[aagaaag g(ucauau)c 8701 cuuuc|accc gauu(ccugu )aaucggguu uaa]auu|GU (G|CAAUG)G CAU-AAA-UA 8761 U-GC-UUGAC UGUAA-GAC( -uauuacuc- )GUCGA-ACA G--------- ---------- 8821 ---------- --------GG AG-------- ---(GUAA-- -)-------- ----CUC-GG 8881 U|---CAUAG UGAUC-CCCA AA-U------ ---------- UCU(------ ---------- 8941 ---------- ---------- ---------- ---------- ----UUAUGG AA)AG|GUUU 9001 GGGCUCAAC- |GGAUAAAAG CUACUC|UAG G|GAUAACAG |G-CUG-A-U CAUUCUUUAG 9061 AG(U--UCCU )AUCGACGGA --AUGGUUUG GC-ACCUCGA UGUC|GG--C U|C|AUCGC| 9121 AU-CC-UGGG GG-UG(--AA -GA)AGCUCC CAAG-GGU|U GGAC(UGUUC )GUCCA-UUA 9181 A--AGCGGU- -+ACGUGAGC UGGGUUUAGA AC|GA-U(GU AA)AUCAGUU CGGACUCUAU 9241 CU|ACUAA-U GG|G|<---- ---------- ---------- ---------- ---------- 9301 >AAGAA-GGA AG-UgacAAG AAU-AGA-AU CC--(UAGU- AC(-GCAA)G GAAU-)GGAU 9361 U--GU-<--- ---------- ---------- -------->G UGAACCU-CU AGUGUACCUG 9421 U|-uga---- ------- 9541 ----ucaUCG CAGG--GUAG CCAC-GUUCA UAA------- ---------- -------aaa 9601 ---------- -AUAAGAGUU (GAAAGC--A UCUAA)A-AC -UC-GAAGUU ga-UCUU--- 9661 gaaAC--U-- -UCUUU-<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 ---------- ---------- ------>--| ---------- ---------- -aaaaca|CG 9961 CUA(GAGACU A--)UAGCGa ---------- ---------- ---------- ------AAUA 10021 G|GUcauaag ---------- ---------- ---------- ---------- ---------- 10081 ---------- --uaugauaA CCC------- ---------- --------(- ---------- 10141 ---------- -------GAG A)GGGU---- ---------- ---------- ---------- 10201 -----cggcu g|a|augAUA CUAau----- ---------- ---------- -----aguua 10261 uuua------ ---------- ---------- ---------- ---------- ---uccuugg 10321 uauguu--|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (4)-METAZO 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (5)-EUMETA 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (6)-BILATE 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (7)-COELOM 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (8)-DEUTER 10775 bp RNA RNA 09-JAN-1999 DEFINITION DEUTEROSTOMIA. ACCESSION No information KEYWORDS No information. SOURCE DEUTEROSTOMIA. ORGANISM DEUTEROSTOMIA. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (9)-CHORDA 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.P.stolo 10775 bp RNA RNA 11-JAN-191 DEFINITION Pyura stolonifera. ACCESSION No information KEYWORDS No information. SOURCE Pyura stolonifera. ORGANISM Pyura stolonifera. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: X74513 ID MIPS16SRA standard; DNA; ORG; 1556 BP. XX AC X74513; XX DT 25-SEP-1993 (Rel. 37, Created) DT 25-SEP-1993 (Rel. 37, Last updated, Version 2) XX DE P.stolonifera mitochondrial 16S ribosmal RNA gene XX KW 16S ribosomal RNA. XX OS Pyura stolonifera OC Eukaryota; Animalia; Metazoa; Chordata; Tunicata; Ascidiacea; OC Stolidobranchia; Pyuridae. XX OG Mitochondrion XX RN [1] RA Crafford T., Durrheim G.A., Corfield V.A.; RT "Sequence of the Mitochondrial tRNAHis gene from the Tunicate RT Pyura stolonifera"; RL Unpublished. XX RN [2] RP 1-1556 RA Crafford T.T.; RT ; RL Submitted (13-SEP-1993) on tape to the EMBL Data Library by: RL T.T. Crafford, Centre for Molecular & Cellular Biology, University RL of Stellenbosch Med. School, Tygerberg, 7505, SOUTH AFRICA XX FH Key Location/Qualifiers FH FT source 1..1556 FT /organism="Pyura stolonifera" FT /mitochondrion XX SQ Sequence 1556 BP; 511 A; 136 C; 304 G; 605 T; 0 other; BASE COUNT 511 a 136 c 304 g 605 t 9219 others ORIGIN 1 |cuuguuauu uugcugauga uccucguuau auauuauaua gau--aguau u-uuguguau 61 guccguuuau aagcuguuug aaacguuuuu gauaaaauuu caggucgcca ugcuuauauc 121 uaugaauuua ugaguuacag uauauuuucu auaaaaaucu gaauugagau auuuugugaa 181 uuaggacuua uuaga----- ---------- ----uaaaaa gaggaaauua uucuguuuug 241 a--------- ---------- ---------- ---------- ---------- ---------- 301 ---------- ---------- ---------- ---------- ---------- ---------- 361 ---------- ---------- ---------- ---------- ---------- ---------- 421 ---------- ---------- ---------- ---------- ---------- ---------- 481 ---------- ---------- ---------- ---------- ---------- ---------- 541 ---------- ---------- ---- ---------- |-----gaaa 841 uaa(uucu)u u--------- ---------- ---------- ---------- ------aaua 901 ugag------ ---------- |----uaGA- -GUAU-U(-- GGGA)AAGAA -gu------- 961 ------------- 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> ---------- ---------- ---|-(---) 1321 ---------- ---------- ---------- ---------- ---------- ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- ---------- ---------- ---------- 1561 ---------- ---------- ---------- ---------- ---------- ---------- 1621 ---------- ------uaau auug-uugu- ----GUAAA( -GUUA-)UUC ---UAUA--- 1681 ---------- ---------- ---------- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- ---------- --<------- -aua------ ---------- ---------- 1861 -gaag>uuag guuauauuu- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (----auuug 2041 --)------- --aaaugu-U UGCCUU(UU- GUAUA)AUGA |AUU-GACGA GU--g--uua 2101 uag------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- ---------- ---------- 2521 ---------- ------<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 -------uuu gguu->---- ---------- ---------- ---------- ------ua-a 2701 uaa-auCUCG AA-AAACU-U UGauuuaguu uga-uu---- ---------- ---------- 2761 -(-------- ---------- ---------- ---------- ----guuug) ---------- 2821 ---------- -u-u-UCUU( GUUGAAA-U) AAGA-aag-- ---uaaagu- caaguua-gG 2881 GU(G-AAAC) ACU-AGUC-A G-AUGGUUAG AUAUCU-AGU UUUUG--UUG GA-GGG-UCU 2941 (-auu-)AUG UU-ag----- ---------- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 --------|- ---------- ---------- ---------- ---------- ---------- 3121 ---------- ---------- ---------- ---------- ---------- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---------- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ---------- ------AUUA CAGGA--UG- AA-GG(-GUC 3481 -AG)CUUUCA UC-CU----- uuaag--aau -uaaguauuu ugguuaaguu auuaaauuua 3541 uuuuauuugu aau------- ---------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- ---------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- ---------- ---------- 3781 ---------- -------(-- --)------- ---------- ---------- ---------- 3841 ---------- ---------- ---------- ---------- ---------- ---------- 3901 ---------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 ---------- ---------| ---------- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- -------uuu aaggg-ag|u gc-uuuug-- ---------- 4501 ---------- ---------- (gaaa---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- ---------| --caaaugau uuAAUGU-UA 4681 AC|UCGAGUA -CUAA-uu-- ---------- (--------- ---------- ---------- 4741 ---------- -----)---- ------|--- ---------- ---------- -|-------- 4801 ---------- ---------- ---------- --)------- ---------- ---------- 4861 ---------- ---------- ---------- ---------- ---------- ---------------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ------|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---|------ ---------- ---------- ---------- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ---<------ 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---------- ---------- -------|-- 6481 ---------- -(------)- ---------- ----(----- ------)--- -----uugu| 6541 |---uuu--U u--aaaaUUA -AAUC-AGGA AUUCGACAAA ---------- ----(----- 6601 )--------- ---|------ ---------- -----(---- ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->------ ---------- 6781 ----|-(--- )--------a aaAUAGCU|C GU---AUG-U UU(AAUAA)A GA-CAUA-GU 6841 UUAUUG|A-- ---------- ---------- (--guc---- ------)--- ---------- 6901 ------UUA- UAA-UAAAUC AGAUCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CU-CA-AU|G U--------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------a agu)------ ---------- ---------| 7141 ----AUA-AA U-|AG-C|-G -GGG---(G- --UUU)--UC UU|U(UAA)- AG-UAGCGUA 7201 AUA-AU-U-U |GUCUAU(-U AAUU-)GUAG AC|UA-GU-- GAAAGAUUAG C-CG-GGUUA 7261 Ug-------- ---------- -------auu uUCUUGUUUA Aaa-----gu ----ag-uaa 7321 au|u|uuuuU UA-AG(UCGA AAAUA)CUUA AAU----AUU CAAAAAAGAA AAAAAGCACC 7381 CUA-GG-|-U GGUUA--AAA UU|-aa--gu guauguua-| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<------- ---------- -------uug 7561 ug-u------ ---------- ---------- ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- ---------- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---u ggaau-a-ua -uug--A-GG UUUAAGUUG( 8161 GGG)UA-AC- U|AUUAGA(- --------aa uau--aauu- )UCUA-AU|g |u|uuu--|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---------- ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ---------- ---------( ---------- )--------- ---------- ---------- 8821 ---------- ---------- ---------- ------uag- -a-------- ----cu--ag 8881 a|---gc--- ---uu-aguu uu-u------ ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- ---------u ga)--|agaa 9001 gcuuuuuac- |uau-agAAC CAACCC|UAG G|GAUAACAG |C-GCA-A-U UAACUAUAUA 9061 AG(U--UCAU )AUUUAuUAG --UUAGGUUA CG-ACCUCGA UGUC|GG--C U|U-AGAUA| 9121 UU-CU-AUUA AG-CG(--CA -GA)AGCUUA AUGG-GUU|U UGUU(UGUUC )UCCAA-GUA 9181 ---GAAUCU- --ACGUGAGU UGGGUUUAGA AC|GA-G(GU GA)CUUAGUU UAGAUUUUUU 9241 CU|UUUau-- --|-|<---- ---------- ---------- ---------- -----augu- 9301 >--------- ---------- --a-uua-ua gu--(UAGU- AC(-GAAA)G GAAU-)ucua 9361 u--ua-<--- ---------- ---------- -------->a aauuu----- ---------- 9421 -|-------- (-----)<-- ---------- ---------- ---------- ---------- 9481 ---------- ---------- ---------- ---------- ---------- -----uga-> 9541 ---------- ---------- -----aaguu gauaaaaacc augg~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (10)-CEPHA 10775 bp RNA RNA 09-JAN-1999 DEFINITION CEPHALOCHORDATA. ACCESSION No information KEYWORDS No information. SOURCE CEPHALOCHORDATA. ORGANISM CEPHALOCHORDATA. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.B.lance 10775 bp RNA RNA 03-JUL-1998 DEFINITION Mitochondrion Branchiostoma lanceolatum.; 12S ribosomal RNA; 12S rRNA gene; 16S ribosomal RNA; 16S rRNA gene; ATPase 6 gene; ATPase 8 gene; COII gene; COIII gene; cytb gene; cytochrome b; cytochrome c oxidase subunit II; cytochrome c oxidase subunit III; NADH dehydrogenase subunit 2; NADH dehydrogenase subunit 3; NADH dehydrogenase subunit 4; NADH dehydrogenase subunit 4L; NADH dehydrogenase subunit 5; NADH dehydrogenase subunit 6; NADH2 gene; NADH3 gene; NADH4 gene; NADH4L gene; NADH5 gene; NADH6 gene; tRNA-Ala gene; tRNA-Arg gene; tRNA-Asn gene; tRNA-Asp gene; tRNA-Cys gene; tRNA-Gln gene; tRNA-Glu gene; tRNA-Gly gene; tRNA-His gene; tRNA-Ile gene; tRNA-Leu gene; tRNA-Lys gene; tRNA-Met gene; tRNA-Phe gene; tRNA-Pro gene; tRNA-Ser gene; tRNA-Thr gene; tRNA-Trp gene; tRNA-Tyr gene; tRNA-Val gene. ACCESSION Y16474 KEYWORDS 12S ribosomal RNA; 12S rRNA gene; 16S ribosomal RNA; 16S rRNA gene; ATPase 6 gene; ATPase 8 gene; COII gene; COIII gene; cytb gene; cytochrome b; cytochrome c oxidase subunit II; cytochrome c oxidase subunit III; NADH dehydrogenase subunit 2; NADH dehydrogenase subunit 3; NADH dehydrogenase subunit 4; NADH dehydrogenase subunit 4L; NADH dehydrogenase subunit 5; NADH dehydrogenase subunit 6; NADH2 gene; NADH3 gene; NADH4 gene; NADH4L gene; NADH5 gene; NADH6 gene; tRNA-Ala gene; tRNA-Arg gene; tRNA-Asn gene; tRNA-Asp gene; tRNA-Cys gene; tRNA-Gln gene; tRNA-Glu gene; tRNA-Gly gene; tRNA-His gene; tRNA-Ile gene; tRNA-Leu gene; tRNA-Lys gene; tRNA-Met gene; tRNA-Phe gene; tRNA-Pro gene; tRNA-Ser gene; tRNA-Thr gene; tRNA-Trp gene; tRNA-Tyr gene; tRNA-Val gene. SOURCE Mitochondrion Branchiostoma lanceolatum. ORGANISM Mitochondrion Branchiostoma lanceolatum. REFERENCE 1 (bases 1 to 15076) AUTHORS Spruyt,N., Delarbre,C., Gachelin,G. and Laudet,V. TITLE mitochondrial genome : relations to vertebrates Complete sequence of the amphioxus (Branchiostoma lanceolatum) JOURNAL Nucleic Acids Res. 26, 3279-3285 (1998) STANDARD No information REFERENCE 2 (bases 1 to 15076) AUTHORS Laudet,V. TITLE Direct Submission JOURNAL Submitted (11-FEB-1998) V. Laudet, Ecole Normale Superieure de Lyon, CNRS UMR 49, 46 Allee d'Italie, 69364 Lyon Cedex 07, FRANCE STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: Y16474 Related sequence: Y09524. BASE COUNT 439 a 196 c 288 g 444 t 9408 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 301 |~~~~~~~~| ~~~~~~~~~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~(~~~~ 361 ~~~~~~~~~) ~|~~~~~~~~ ~~~~~~~|~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ 421 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~(~~~~ 481 )~~~|~~~~~ ~~(~~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~)~ 541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~uaac cCAAAG---- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (-guaaacuc 2041 --)------- -----uau-u uuCCUU(UU- GCAUA)AUGA |uuu-aauua gggcacuug- 2101 cuagcguu-- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- -aauu>---- --(------) ---------- ---------- --agu-guua 2701 gua-AUCCCG AA-ACUAA-A CG-AUUUAUU CUA-GUC-CU AGUA------ ---------- 2761 -(-------- ---------- ---------- ---------- --aauuaau) ---------- 2821 -GACUUAA-C UA-AUCUAU( GUUGCAA-U) AUAG-UUAGA --UGAGGCU- AGAAUGG-GG 2881 GU(G-ACAU) GCU-AAUC-G C-GUUUAGUU CUAGCU-GGU UAUUC--AAG AA-AUG-AAU 2941 (-AAGA)GUU CA-gc-uuug ua----AGU-U GGC(UUAAAA 3781 GC-A)-GCCA -ucuu|g(u- aa)u|AACAG C(--GUUAUA )GC|-UUA-- -------------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|-- ---u--uga| a--u-aa|-- --------cu ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ---------- -------cuu auaga-au|- uu-uaugu-- ---------- 4501 ---------- ---------- (uaaa---)< -augcguagg uu-------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- -|-------| -aacuaacuc uuaacac-ag 4681 au|GUAAGUA -AUUU-UAC- u--------- (-cuuug--- ---------- ---------- 4741 ---------- -----)---- ------|uau u-uu---guu cug-gauaaa g--------- 4801 ---------- ---------- ---------- --)------- ---------- ---------- 4861 ---aauuaa- ---ug----- ---------- ---------- ---------- ---------- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 ---------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ---------- ---------- ---------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---------- ---------- ---------- ---------- 5521 ---------- ---------- ---------- ---------- ---------- ---------- 5581 ---------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ---------- ---------- ---------- ---------- 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ---------- ---------- ---------- ---------- 6481 --ugaagcu- -(-a-aca)g g|agagu--- ----(gua-- ------)--- ----auuga| 6541 |----guu-a cauaauUAGG -GGGA-AGGA ACUCGGCAAA ---------- ----(----- 6601 )--------- ---|------ ---------- -----(---- ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->------ ---------- 6781 ----|-(--- )--------c agGAAGCU|C GC---CUG-U UU(AACAA)A AA-CAUC-GC 6841 CUUUAG|--- ---------- ---------- (-acua---- ------)--- ---------- 6901 ------AUA- UUA-AAGGUC UGGUCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CG-GU|G -U-------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------a auu)------ ---------- ---------| 7141 ---A-UU-AA C-|GG-C|-C -GCGGU-(AU -UCUG)ACUG UG|C(AAA)- GG-UAGCAUA 7201 AUC-AC-U-U |GCCCUU(-U AAAU-)GGGG GA|AU-GUAU GAAUGAUUAG A-CGAGGUUU 7261 CG-------- ---------- -------ACU GUCUUCCCCC UAAA-AA-C- -----ugaga 7321 uu|u|cagUG UC-UG(U-GA AAAUG)CGGG CAU----GGC UGUAAUGGAC GAGAAG-ACC 7381 CUGUUG-|-A GCUUG--AAG Ac|--uacau au---ua--| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- -- --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- --auu-a-aa -cg---G-UC UUUUGGCUG( 8161 GGG)UG-GC- A|AGCAAA(- --------GG AAUUA-AGC- )UUUG-AU|A |U|uaa--|< 8221 auuuacau-- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ---------- uuuua-ggc( uguuuau--- )gccaa-gga auau------ ---------- 8821 ---------- ---------- ---------- ---------- ---------- ---------u 8881 a|---au-ac aGAUC-CGC- ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- -------uaa ga)--|---- 9001 GCGAUUAAU- |AGA-UAAAG UUACCA|CAG G|GAUAACAG |C-GUA-A-U CCUUUUUGAG 9061 AG(C--CCAU )AUUGACAAA --AGGGUUUG CG-ACCUCGA UGUU|GG--A U|C|AAGAU| 9121 -U-CC-UAAU GG-UG(--UA -GC)AGCUAU UAUG-GGU|U UGCC(UGUUC )GGCGA-UUA 9181 A--AAUCUU- --ACGUGAUC UGAGUACAGA CC|GU-C(GU AA)GACAGGU UAGAUUCUAU 9241 CC|UUA---- --|-|<---- ---------- ---------- ---------- -----cauu- 9301 >--------- ---------- --c-aca-ua uu--(UAGU- AC(-GAAA)G GACC-)aaug 9361 ---gu-<--- ---------- ---------- -------->g uguaauu--u uaag------ 9421 -|-------- (-----)<-- ---------- ---------- ---------- ---------- 9481 ---------- ---------- ---------- ---------- ---------- ---guuuu-> 9541 ---------- --------uu uaaa-uuaua ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9601 ~~~~~~~~~~ ~~~~~~~~~~ (~~~~~~~~~ ~~~~~)~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9661 ~~~~~~~~~~ ~~~~~~~<~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9721 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9781 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9841 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 9901 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~>~~| ~~~~~~(~~~ )~~~~~~~~~ ~~~~~~~|~~ 9961 ~~~(~~~~~~ ~~~)~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (10)-VERTE 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.N.cryso 10775 bp RNA RNA 02-JUN-1998 DEFINITION Mitochondrion Notemigonus crysoleucas.; . ACCESSION AF0384 7 KEYWORDS . SOURCE Mitochondrion Notemigonus crysoleucas. ORGANISM Mitochondrion Notemigonus crysoleucas. REFERENCE 1 (bases 1 to 1758) AUTHORS Simons,A.M. and Mayden,R.L. TITLE Phylogenetic Relationships of the Western North American Phoxinins (Actinopterygii: Cyprinidae) as Inferred from Mitochondrial 12S and 16S Ribosomal RNA Sequences JOURNAL Mol. Phylogenet. Evol. (1998) In press STANDARD No information REFERENCE 2 (bases 1 to 1758) AUTHORS Simons,A.M. and Mayden,R.L. TITLE Direct Submission JOURNAL Submitted (15-DEC-1997) Department of Biological Sciences, The University of Alabama, Box 870344, Tuscaloosa, AL 35487-0344, USA STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: AF038487 BASE COUNT 584 a 384 c 367 g 370 t 9070 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~ug caaauuggau ca-cccugaG C--------- ----caacca 301 |gcu--agc| uu-------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---- ---------- |------aac 841 uAA(ACCA)U Uuu------- ---------- ---------- ---------- --------uu 901 ------(--- --)------- |ugc-cuaA- -GUAC-G(-G GAGA)CGGAA -aaggu---- 961 -------<-- --ucaacuu- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- --AAAGCAAU AGAG-AA--- ---AGUACC( -GCAA-)GG- ---AAA-GC- 1681 ugaaagagaa augaaauaac ccaua----- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- -----uaa-G C-AAAA ACAAAG---- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--acuaaac 2041 --)------- -----CUU-G U-CCUU(UU- GCAUC)AUGA |UUU-AGCCA GUacc--cu- 2101 caagcaaag- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- agac->---- --(------) ---------- ---------- --uuu-guuu 2701 gac-gcCCCg AA-ACCAG-G UG-AGCUACC CCG-AGA-CA GCCU------ ---------- 2761 -(-------- ---------- ---------- --------au guuaaucua) ---------- 2821 -GGGCCAA-C CC-GUCUCU( GUGGCAA-A) AGAG-UGGGA --AGAGCUC- CGGGUAG-AA 2881 GU(G-ACAG) ACC-UACC-G A-ACCUGGUG AUAGCU-GGU UGCCU--GAG AA-AUG-GAU 2941 (-AGAA)GUU CA-GC-CUCG UAuu<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->-- ---|------ 3061 -|------|- ---------- ---------- --------(- --------)< accccaaacc 3121 aaag-----a acauaucacu aagguaauu- ---------- ---------- ---------- 3181 ----agagau ac-------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ----|----- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ------AU-A -CGAG-AGUU AGUUA--AA- GG-GG(-GUA 3481 CAG)CCCCUU UA-AC----- -aAAGG(AUA -CAA)CCU-u uacag-g-ag -ga-UAA--- 3541 --agaucaua auauaua-a- aacaua---- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ------cugu u<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->CUAGU-G GGC(CUAAAA 3781 GC-A)-GCCA -CCUA|-(a- ac)a|GAAAG C(--GUUAAA )GC|-UCAg- acag--<--- 3841 --aaaaaagu uuauuauacc gauaaaaaa- ---------- ---------- ---------- 3901 ->-------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|uc uuac--ucc| c--c-ua|-- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- -----auuau auCAG-GC|- CA-GCCCAUG ---------- 4501 ---------- ---------- -ccaa----- ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- ---------| CAUGGGAGAG AUUAUGC-UA 4681 AA|AUGAGUA -ACAA-GAA- ga-------- (-ccugcucu ---------- ---------- 4741 ---------- -----)---- ---uc-|ucc ----ca-GCA CAA--gugua a|----acca 4801 gauc----gg ---------- ----(--aca aa)c-c|--g cuggaa---- ---------- 4861 ---cuuaa-- -cga------ ---------- -------(-- ---------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--------- ---------- ---------- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ---<------ 5701 ---------- acccaaccca agaggguaau gugaauaaua uuagaccuca ggaaaaacuc 5761 acaucugaau aa-------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---------- ---------- --ucgu-|-- 6481 ---uAACCC- -(UACACU)G G|CGUGC--- -----uacuu uaag------ -----ggaa| 6541 |---AGAC-U A--AAAGAAG -GGGA-AGGA ACUCGGCAAA ---------- ---------- 6601 ---------- ---------- ---------- ---------- ---------- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- ---------- ---------- 6781 ------(--- )--------c acAAGCCU|C GC---CUG-U UU(ACCAA)A AA-CAUC-GC 6841 CUCCUG|C-- ---------- ---------- (aacuggauu ga----)--- ---------- 6901 ------GUA- UAG-GAGGUC CAGCCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CA-GU|G AC-------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- --------ua cgg)------ ---------- ---------| 7141 ---GUUC-AA C-|GG-C|-C -GCGGU-(AU -UUUG)ACCG UG|C(AAA)- GG-UAGCGCA 7201 AUC-AC-U-U |GUCUCU(-U AAAU-)AGAG AC|CU-GUAU GAAUGGCUAG A-CGAGGGCU 7261 UA-------- ---------- -------ACU GUCUCCCCCC UCCA-GU-CA ----GUGAAA 7321 UU|G|AUCUA UC-CG(U-GC AGAAG)CGGG UUU----AAC UAUACAAGAC GAGAAG-ACC 7381 CUUUGG-|-A GCUUA--AGG UA|-caaagu uca--a---| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<------- ------ccac guuaa-acga 7561 cu-acacaaa aagcaagaac uuaguggcga g--------- ---------- ---------- 7621 ---------- ---------- ---------- ---------- ---------- ---------- 7681 ---------- ---------- ---------- ---------- ---------- ---------- 7741 ---------- ---------- ---------- ---------- ---------- ---------- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- ----u-gaaa uuu---U-AC CUUCGGUUG( 8161 GGG)CG-AC- C|ACGGAG(- --------GA GAAAAGAGC- )CUCC-GA|G |u|gg---|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ------acug 8341 ggccaa-a-- uccca----- ---------- ---------- ---------- ---------- 8401 ---------- ---------- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------- ---------- ---------- ---------- ---------- 8701 ---------- ---------- ---------- ---------- --|------- ---------- 8761 --------aa gccaa-uag( -auacau--- )cuaua-agc -cgcagaaca ucug------ 8821 ---------- ---------- ---------- ---------- ---------- --------ac 8881 c|---aauaa UGAUC-cggc u--------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- --------ga aa)--|--ag 9001 gc-AUCAAC- |GAA-CCAAG UUACCC|UAG G|GAUAACAG |C-GCA-A-U CCUCUCCCAG 9061 AG(U--CCAU )AUCGACGAG --GGGGUUUA CG-ACCUCGA UGUU|GG--A U|C|AGGAC| 9121 AU-CC-UAAU GG-UG(--CA -GC)CGCUAU UAAG-GGU|U CGUU(UGUUC )AACGA-UUA 9181 A--AGUCCU- --ACGUGAUC UGAGUUCAGA CC|GG-A(GC AA)UCCAGGU CAGUUUCUAU 9241 CU|GUA---- --|-|<---- ---------- ---------- ---------- -----gcgc- 9301 >--------- ---------- -uA-CUU-UU CC--(UAGU- AC(-GAAA)G GAUC-)GGAA 9361 A--AG-- ggggccu-au ac-------- 9421 -|-------- (-----) 9541 ---------- ---------- gcau-gcccc acc------- ---------- -------ccu 9601 ---------- ---aauugau (gaaaac--a aauaa)a-uu -aa-guaaag g--------- 9661 ---------- -------<-- ----gaggg- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 -------cua aaaccccuac c----->--| ------(--- )--------- -------|gu 9961 cc-(gaaaua a--)-ggaca ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (11)-AGNAT 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.P.marin 10775 bp RNA RNA 11-JAN-191 DEFINITION Mitochondrion Petromyzon marinus. ACCESSION No information KEYWORDS No information. SOURCE Mitochondrion Petromyzon marinus. ORGANISM Mitochondrion Petromyzon marinus. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: U11880 LOCUS PMU11880 16201 bp DNA Circular VRT 25-JUL-1994 DEFINITION Petromyzon marinus mitochondrion, complete genome. ACCESSION U11880 KEYWORDS . SOURCE sea lamprey ORGANISM Mitochondrion Petromyzon marinus Eukaryotae; Hyperchondria; Eukaryote crown group; Metazoa/Eumycota group; Metazoa; Eumetazoa; Bilateria; Coelomata; Deuterostomia; Chordata; Vertebrata; Petromyzontiformes; Petromyzontidae; Petromyzon. REFERENCE 1 (bases 1 to 16201) AUTHORS Lee,W.-J. and Kocher,T.D. TITLE Complete sequence of a sea lamprey (Petromyzon marinus) mitochondrial genome: A unique gene order and significance for the evolution of mitochondrial genome structure JOURNAL Unpublished STANDARD full automatic REFERENCE 2 (bases 1 to 16201) AUTHORS Lee,W.-J. TITLE Direct Submission JOURNAL Submitted (06-JUL-1994) Woo-Jai Lee, Zoology, University of New Hampshire, Spaulding Life Science Building, Durham, NH 03824, USA STANDARD full automatic COMMENT NCBI gi: 515484 FEATURES Location/Qualifiers tRNA complement(1195..1265) /product="tRNA-Pro" /anticodon=(pos:1231..1233,aa:Pro) tRNA 1276..1343 /product="tRNA-Phe" /anticodon=(pos:1309..1311,aa:Phe) rRNA 1344..2243 /product="12S ribosomal RNA" tRNA 2244..2314 /product="tRNA-Val" /anticodon=(pos:2276..2278,aa:Val) rRNA 2315..3935 /product="16S ribosomal RNA" tRNA 3936..4009 /product="tRNA-Leu" /anticodon=(pos:3971..3973,aa:Leu) /note="UUR" tRNA 5003..5071 /product="tRNA-Ile" /anticodon=(pos:5033..5035,aa:Ile) tRNA complement(5074..5144) /product="tRNA-Gln" /anticodon=(pos:5110..5112,aa:Gln) tRNA 5145..5212 /product="tRNA-Met" /anticodon=(pos:5176..5178,aa:Met) tRNA 6256..6323 /product="tRNA-Trp" /anticodon=(pos:6285..6287,aa:Trp) tRNA complement(6325..6393) /product="tRNA-Ala" /anticodon=(pos:6334..6336,aa:Ala) tRNA complement(6397..6465) /product="tRNA-Asn" /anticodon=(pos:6434..6436,aa:Asn) tRNA complement(6467..6532) /product="tRNA-Cys" /anticodon=(pos:6502..6504,aa:Cys) tRNA complement(6538..6608) /product="tRNA-Tyr" /anticodon=(pos:6574..6576,aa:Tyr) tRNA complement(8154..8224) /product="tRNA-Ser" /anticodon=(pos:8189..8191,aa:Ser) /note="UCN" tRNA 8226..8294 /product="tRNA-Asp" /anticodon=(pos:8256..8258,aa:Asp) tRNA 8996..9061 /product="tRNA-Lys" /anticodon=(pos:9024..9026,aa:Lys) tRNA 10695..10764 /product="tRNA-Gly" /anticodon=(pos:10725..10727,aa:Gly) tRNA 11120..11185 /product="tRNA-Arg" /anticodon=(pos:11150..11152,aa:Arg) tRNA 12856..12924 /product="tRNA-His" /anticodon=(pos:12886..12888,aa:His) tRNA 12925..12994 /product="tRNA-Ser" /anticodon=(pos:12952..12954,aa:Ser) /note="AGY" tRNA 12995..13066 /product="tRNA-Leu" /anticodon=(pos:13028..13030,aa:Leu) /note="CUN" D-loop 15368..15858 tRNA 15859..15930 /product="tRNA-Thr" /anticodon=(pos:15891..15893,aa:Thr) tRNA complement(15932..16002) /product="tRNA-Glu" /anticodon=(pos:15968..15970,aa:Glu) repeat_region 16003..16201 source 1..16201 /organism="Petromyzon marinus" /dev_stage="adult" /mitochondrion CDS 1..1191 /note="NCBI gi: 515485" /product="cytochrome b" /codon_start=1 /translation="MSHQPSIIRKTHPLLSLGNSMLVDLPSPANISAWWNFGSLLSLC LILQIITGLILAMHYTANTELAFSSVMHICRDVNNGWLMRNLHANGASMFFICIYAHI GRGIYYGSYLYKETWNVGVILFALTAATAFVGYVLPWGQMSFWGATVITNLISAMPYV GNDIVVWLWGGFSVSNATLTRFFTFHFILPFILAAMTMIHIMFLHQTGSSNPMGINSN LDKIQFHPYFSFKDILGFVILLGILFMISLLAPNALGEPDNFIYANPLSTPPHIKPEW YFLFAYAILRSVPNKLGGVVALAAAIMILLIIPFTHTSKQRGMQFRPLAQITFWILIA DLALLTWLGGEPAEYPFILMTQIASTVYFMIFILVFPILGYLENKMLLMSKNTGKFNW KLVY" CDS 4014..4979 /note="NCBI gi: 515486" /product="NADH dehydrogenase subunit 1" /codon_start=1 /translation="MLIMLTSTLILVLMVLLAVAFLTMVERKTLGYMQLRKGPNVVGF MGLLQPIADGVKLFLKEPVWPLAASPILFIVAPIMALTLALSLWMLIPMPQSISTINI TLLVIMAISSLSVYAILGSGWASNSKYALIGALRAVAQTISYEVSLGLILLCLVILTG SFSLQAFIYTQEHTWFLLSSWPLAAMWFVSTLAETNRTPFDLTEGESELVSGFNVEYA GGPFALFFLAEYSNILFMNTLTAIMFLGPLGSNNLNILPIINIMMKATPLIILFLWIR ASYPRFRYDQLMHLMWKNFLPLNLALFTLQLSLAVSFGGAGVPQM" CDS 5214..6257 /note="NCBI gi: 515487" /product="NADH dehydrogenase subunit 2" /codon_start=1 /translation="MLSPLIQSTLLMTLGLGTLVTFSSTSWILAWIGLEINTIAIIPL MAKTHHPRSIEATTKYFIAQSAGSATLLITACLTAWYSGNWAISPSNDPIILNAMTLA LMLKLGMAPMHFWLPEVMVGLDFITGMILATWQKLAPITLLIQIAQDQNNMFILIPAL LSVFVGGWGGLNQTQTRKILAYSSIAHMGWITSMAPFNPTITWLTTLIYCLITSATFI NLHILKANKITALTMNKHNQISQMLLLLLLLSLGGLPPLTGFINKLLASIELANQNLI IYLFMMMMGSLLSLFFYTRMCYLSIILSPPCSTTNLILWRVVSNKPMTLITMLSTNLF IMTPQLLAVFTLH" CDS 6610..8163 /note="GTG start codon. NCBI gi: 515488." /product="cytochrome oxidase subunit I" /codon_start=1 /translation="MTHIRWLFSTNHKDIGTLYLIFGAWAGMVGTALSILIRAELSQP GTLLGDDQIFNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSF WLLPPSLLLLLASAGVEAGAGTGWTVYPPLAGNLAHTGASVDLTIFSLHLAGVSSILG AVNFITTIFNMKPPTMTQYQTPLFVWSVLITAVLLLLSLPVLAAAITMLLTDRNLNTS FFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVAYYAGKKEPFGYMGMVWA MMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGKIVW HTPMLWALGFIFLFTVGGLTGIVLSNSSLDIILHDTYYVVAHFHYVLSMGAVFAIMAG FVHWFPLFTGYTLNETWAKAHFIIMFAGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTW NIISSIGSTVSLIAVMLFMFILWEAFSAKRKAIATDLLNTNLEWLHGCPPPYHTYEEP AFVQTNFKK" CDS 8298..8987 /note="NCBI gi: 515489" /product="cytochrome oxidase subunit II" /codon_start=1 /translation="MAQQAQLGLQDAASPIMEELIHFHDHTLTVVFLISVLIFYLIIV MVTTTFMNKHSLDSQEVEIVWTVMPAIVLITIALPSLRILYLTDEISNPHLTIKAVGH QWYWSYEYTDYHQMEFDSYMIPTNELEPGGIRLLDVDHRIVVPMESPVRMLITSEDVI HSWTIPSLGTKVDAVPGRLNQATFITTRPGLFFGQCSEICGANHSFMPIALEAVPLSN FENWTTKVLAS" CDS 9064..9231 /note="NCBI gi: 515490" /product="ATPase 8" /codon_start=1 /translation="MPQLDPAPWFSMLTVSWLIIFLLIMPTILFYQPQNTISTKQVTK PKQSTWTWPWH" CDS 9222..9935 /note="NCBI gi: 515491" /product="ATPase 6" /codon_start=1 /translation="MTLDIFDQFTSPTMFGLPLAWLAMLAPSLMLVSQTPKFIKSRYH TLLTPILTSIAKQLFLPMNQQGHKWALICMASMMFILMINLLGLLPYTYTPTTQLSMN MGLAVPLWLATVLIGLQKKPTEALAHLLPEGTPAALIPMLIIIETISLFIRPIALGVR LTANLTAGHLLMQLVSMTTFVMIPVISISIITSLLLLLLTILELAVAVIQAYVFILLL TLYLQENVYVPPSSCMPHG" CDS 9901..10686 /note="NCBI gi: 515492" /product="cytochrome oxidase subunit III" /codon_start=1 /translation="MSHQAHAYHMVDPSPWPLTGAGAALLMTSGLAMWFHKNSCILMT LGLILMLLTMYQWWRDIVREGTFLGHHTSPVQQGLRYGMILFIISEVCFFAGFFWAFY HASLAPTPELGLTWPPTGINPLNPFEVPLLNTAVLLASGVSVTWAHHSITEKNRTETT QALTLTVLLGLYFTALQIMEYYETPFTMADGVYGSTFFVATGFHGLHVIIGSLFLLTC LLRHLQYHFTSKHHFGFEAAAWYWHFVDVVWLFLYISIYWWGS" CDS 10765..11115 /note="NCBI gi: 515493" /product="NADH dehydrogenase subunit 3" /codon_start=1 /translation="MNSFMVMIMLTLTLSSIMALLAFWLPIMKPDSEKLSPYECGFDP QGSARLPFSLRFFLVAILFLLFDLEIALLLPSPWATNISNPEFTLLWASLFVLLLTLG LIYEWLQGGLDWAE" CDS 11194..11484 /note="NCBI gi: 515494" /product="NADH dehydrogenase subunit 4L" /codon_start=1 /translation="MPTTLIFTSFFLALLGLSLQRKHLLSLLLTLESMALALYVSTAL WALNNTSLPIMAAPLIILTFSACEAGMGLSLMIATARTHNTDQLKALNLLKC" CDS 11478..12854 /note="NCBI gi: 515495" /product="NADH dehydrogenase subunit 4" /codon_start=1 /translation="MLKLIIPSIMLIPMTFLINKKSLLWTATTFFSFLIAALSTLTLN MDVAEHNSTNPLLSIDQFSCPLIMLSCWLLPLTIMGSQAHMKTEPITRQKTMISLLIL LQVLLCITFGASNLLMFYIAFETTLIPTLLIITRWGNQKERLTAGLYFLFYTLSASLP LLLALIMIQTHLNSLSIYIIPLSNLTLLLNTPWSETLWWIACFLAFLIKMPLYIFHLW LPKAHVEAPIAGSMILAAILLKLGGYGMIRMSSLFIPLTKDLAVPFMIIAMWGMIVTS SICLRQTDLKSMIAYSSVSHMGLVVAGIFTMTPWAWSGALAMMIAHGLVSSGLLCLAN ITYERTHTRSIFMNRGLKTLFPLMSFWWLMMTFANMALPPFPNFMAEILIITSLFNWS NWTILLLGLSMTLTALFSLNMLIMTQHEHPNKHAPVNPSTTREHLLMLMHMAPIILLI ANPSAIMI" CDS 13068..14864 /note="NCBI gi: 515496" /product="NADH dehydrogenase subunit 5" /codon_start=1 /translation="MNSHYLTLIMNSGALLTIIVLLPPIIMPKPSMILTTKLVKISMF ISLIPLTIYLNENMETTLTMKPWMDWALFNIALSFKIDKYTVIFTPIALMITWSIMEF SQWYMAKERHMDKFFKYLLLFLITMITFISANNLLQLFIGWEGVGIMSFLLISWWSGR TKANISALQAVAYNRIGDIGLMMSMVWMCSNTNSWDLQQITMLLSDQQYLIPTLGFLI AATGKSAQFGLHPWLPAAMEGPTPVSALLHSSTMVVAGVFLLIRLHPLFQNYPLMLEM TLCLGAMTTICAALCATTQNDIKKIIAFSTSSQLGLMMVAVGLNHPHIAFLHMCTHAF FKAMLFLCSGSIIHNMNNEQDIRKFSCLNNNLPLTTTCMTIGSAALMGLPFLAGFFTK DLILEALNTSYTNAWALMVTLMAVTLTTAYSSRLIIMSASGTPRYLPLTPTHENNFIK NPLKRLAWGSLISGLILTSTLPPMKPQIFTMPTYIKTIALMMFIISLIISMELTNKKI NQTTFSFFTQLAFYPHIIHRLTSHLSLIWSQKLMTQVMDVSWLEKIGPKGLANHQLKP STTLTEAHHLNSATLPLMAFALTLITLSLTAR" CDS complement(14849..15367) /note="NCBI gi: 515497" /product="NADH dehydrogenase subunit 6" /codon_start=1 /translation="MLSLVLCFFVMFLLGVAVVVLSPSPYFSALGLVFVAVSGCFIVL YHGGTFLSLVLVLLYLGGMMVVFVYSAALAADPYPEVLGGRVIWFFVICVLCICFAGY MSFNDFFLDVSVACEGADYTGGIFGAEWLGVTTFYEVGLILVLAGWALLVCLFSVLVV VRGVNRGALRAV" BASE COUNT 5227 a 3863 c 2182 g 4929 t ORIGIN BASE COUNT 608 a 337 c 278 g 398 t 9154 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 301 |~~~~~~~~| ~~~~~~~~~~ ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~| ~~~~~(~~~~ 361 ~~~~~~~~~) ~|~~~~~~~~ ~~~~~~~|~~ ~~~~~~~(~~ ~~~~~~~~~~ ~~~~~~~~~~ 421 ~~~~~~~)~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~(~~~~ 481 )~~~|~~~~~ ~~(~~~~~)~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~(~~~~~~)~ 541 ~~~~~~~~~~ ~~~~~~~~~~ ~~~- ---------- |-----accg 841 cAA(ACCA)U Ugc------- ---------- ---------- ---------- ---------- 901 ---------- ------c-cc |cau-uuUA- -GUAU-A(-G GUGA)UAGAA -Aaaaa---- 961 -------<-- ---------- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> ---------- ---------- ---|-(---) 1321 ---------- ---------- ---------- ---------- ---------- ---------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- ---------- ---------- ---------- 1561 ---------- ---------- ---------- ---------- ---------- ---------- 1621 ---------- --auuauaca caua-aua-- ----GUACC( -GCAA-)GGG ---AAU-AU- 1681 UGaaaaagaa gugaaauaaa uugau----- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- -----uaa-G U-CAAA GCAAAG---- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--auuaaau 2041 --)------- -----CUU-G UACCUU(UU- GCAUC)AUGG |CUU-AGCaa gcaaa--cc- 2101 cg-------- ---------- ---------- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- ---------- ---------- 2521 ---------- ------<--- ---------- ---------- ---------- ---------- 2581 -a-------- ---------- ---------- ---------- ---------- ---------- 2641 ------auau acugc>---- ---------- ---------- ---------- ---------c 2701 gcc-acCCCG AA-ACUAG-A CG-AGCUACC CUG-GGA-UU ACCU------ ---------- 2761 -(-------- ---------- ---------- ---------- ----auaa-) ---------- 2821 -GGGUUAA-U CC-GUAUCU( GUGGCAA-A) AGAU-UGGAA --AAACCCC- UGGGUAG-AG 2881 GU(G-AAAA) GCC-UACC-G A-GCCUAGUG AUAGCU-GGU UACUU--AAG AA-ACA-AGU 2941 (-UUAA)GCU UG-AU-CUUA ACUu<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ---------- ---------- 3061 --------|- ---------- ---------- ---------- ---------< guagaugagc 3121 aaca-----a aauuacuuag aaauuuaaac aucuuacucc ucuaca---- ---------- 3181 ---------- ---------- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ---------- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ------CU-U -UAAG-UUUU AUUCA--CU- AG-GG(-GUA 3481 CAG)CCCUAG UG-AA----- -cAGAG(AUA -CAG)CUC-u auuaa-u-ua -ga-UAA--- 3541 --uau-acca cauuuua-a- acu------- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ---------- -<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->uaaGU-A GGC(CUAAAA 3781 GC-A)-GCCA -Ccaa|g(a- ag)-|AAAAG C(--GUUACA )GC|-UUA-- -------------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|-- agac--ccu| a--u-aa|-- --------ac ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ---------- -------acu aUUAA-GU|- AA-UCCUA-- ---------- 4501 ---------- ---------- (uaaa---)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- -|-------| -AUAGGAGAU AUCCUGC-UA 4681 AG|AUUAGUA -AUUU-GAG- c--------- (-ccgcaccc c--------- ---------- 4741 ---------- -----)---- ----u-|cua aauguaaGUG Uac-accaga u|----cgga 4801 c-caac--ca c--------- ---------- --)------- -ugga----- ---------- 4861 ---aauuaa- -cggc----- ---------- ---------- ---------- -------<-c 4921 cuuaaaacaa caggaaguca gaaacauaaa caacaacaag aaaaacaaga acuaaua--- 4981 >--------- ---------- ---------- ---------- ---------- ---------- 5041 ---------- ---------- ---------- ------|--- ---------- |--------- 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ---------- ---------- ---------- ---------- 5461 ---------- ---------- ---|------ ---------- ---------- ---------- 5521 |--------- ---------- ---------- ---------- ---------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ---<------ 5701 ---------- ---------- ---------- ---------- ---------- ---------- 5761 ---------- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---------- ---------- -accg--|-- 6481 --uUAACCC- -(UACACU)G G|AACAU--- ----(aau-- ------)--- ----auaga| 6541 |---AGAU-A U--AAAGGAU -AAGA-AGGA ACUCGGCAAA ---------- ----(----- 6601 )--------- ---|------ ---------- -----(---- ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->------ ---------- 6781 ----|-(--- )--------c acAUGCCU|C GC---CUG-U UU(ACCAA)A AA-CAUC-AC 6841 CUCCAG|--- ---------- ---------- (auaaaaauc aa----)--- ---------- 6901 ------GUA- UUG-GAGGCA AGACCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CA-AU|G AU-------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------u aau)------ ---------- ---------| 7141 ---AUUG-AA U-|GG-C|-C -GCGGU-(AC -UUUG)ACCG UG|U(AAA)- AG-UAGCGUA 7201 AUC-AC-U-U |GUCUUG(-U AAAU-)UAAG AC|UG-GAAU GAAAGGUUAC A-CGAGGGCA 7261 UA-------- ---------- -------ACU GUCUCCUUAU CCCU-AU-CA ----AUGAAA 7321 UU|G|ACCUA CC-CG(U-GC AAAGG)CGGG UAU----AAA CCCAUAAGAC GAGAAG-ACC 7381 CUGUGG-|-A GCUUC-cAAA CA|--u-uua ca---uc--| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- -- --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- --cga-u-gu -ac---A-GU UUUAGGUUG( 8161 GGG)CA-AC- C|ACGGAA(- --------CA AAAGU-AAU- )AUCC-AC|G |a|cga--|< 8221 cgaaaauaua auuuucuaag ccuaga---- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ---------- 8341 ---------- ---------- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ------acca caacu-cua( --agcac--- )uagua-aaa cua------- ---------- 8821 ---------- ---------- ---------- ---------- ---------- -------acg 8881 u|---UA-AU AGACC-CAGC ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- -----aucac uu)--|---G 9001 CUGACUAAC- |GAA-ACAAG UUACCC|CAG G|GAUAACAG |C-GCA-A-U CCUUUCCACG 9061 AG(C--CCGA )AUCAACGAA --AGGGUUUA CG-ACCUCGA UGUU|GG--A U|C|GGGGC| 9121 AC-CC-CAAU GG-CG(--CA -AA)AGCUAU UAAA-GGU|U CGUU(UGUUC )AACGA-UUA 9181 A--AGCCCC- --ACGUGAUC UGAGUUCAGA CC|GG-A(GU AA)UCCAGGU CAGUUUCUAU 9241 CU|AUG---- --|-|<---- ---------- ---------- ---------- ----uuugc- 9301 >--------- ---------- --u-guu-uc cc--(UAGU- AC(-GAAA)G GACC-)ggug 9361 aa-ac-<--- ---------- ---------- -------->a agggucu-au ac-------- 9421 -|-------- (-----)<-- ---------- ---------- ---------- ---------- 9481 ---------- ---------- ---------- ---------- ---------- ---acuuau> 9541 ---------- ---------- gcaa-acccu acaucaau-- ---------- ---------- 9601 ---------- -----ccuau (gaaacc--a acuca)a-ua aga------- ---------- 9661 ---------- ---------| ------(--- )--------- -------|aa 9961 cu-(-agaua ---)-aguuu ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (11)-GNATH 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (12)-CHOND 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.S.canic 10775 bp RNA RNA 17-SEP-1998 DEFINITION Mitochondrion Scyliorhinus canicula.; 12S rRNA; 16S rRNA; ATPase 6; ATPase 8; COI gene; COII gene; COIII gene; complete genome; control region; cytb gene; mitochondrial; NADH1 gene; NADH2 gene; NADH3 gene; NADH4 gene; NADH4L gene; NADH5 gene; NADH6 gene; origin of replication; tRNA-Ala; tRNA-Arg; tRNA-Asn; tRNA-Asp; tRNA-Cys; tRNA-Gln; tRNA-Glu; tRNA-Gly; tRNA-His; tRNA-Ile; tRNA-Leu(CUN); tRNA-Leu(UUR); tRNA-Lys; tRNA-Met; tRNA-Phe; tRNA-Pro; tRNA-Ser(AGY); tRNA-Ser(UCN); tRNA-Thr; tRNA-Trp; tRNA-Tyr; tRNA-Val. ACCESSION Y16067 KEYWORDS 12S rRNA; 16S rRNA; ATPase 6; ATPase 8; COI gene; COII gene; COIII gene; complete genome; control region; cytb gene; mitochondrial; NADH1 gene; NADH2 gene; NADH3 gene; NADH4 gene; NADH4L gene; NADH5 gene; NADH6 gene; origin of replication; tRNA-Ala; tRNA-Arg; tRNA-Asn; tRNA-Asp; tRNA-Cys; tRNA-Gln; tRNA-Glu; tRNA-Gly; tRNA-His; tRNA-Ile; tRNA-Leu(CUN); tRNA-Leu(UUR); tRNA-Lys; tRNA-Met; tRNA-Phe; tRNA-Pro; tRNA-Ser(AGY); tRNA-Ser(UCN); tRNA-Thr; tRNA-Trp; tRNA-Tyr; tRNA-Val. SOURCE Mitochondrion Scyliorhinus canicula. ORGANISM Mitochondrion Scyliorhinus canicula. REFERENCE 1 (bases 1 to 16697) AUTHORS Delarbre,C., Spruyt,N., Delmarre,C., Gallut,C., Barriel,V., Janvier,P., Laudet,V. and Gachelin,G. TITLE The complete nucleotide sequence of the mitochondrial DNA of the dogfish, scyliorhinus canicula JOURNAL Genetics 150 (1), 331-344 (1998) STANDARD No information REFERENCE 2 (bases 1 to 16697) AUTHORS Gachelin,G. TITLE Direct Submission JOURNAL Submitted (30-DEC-1997) G. Gachelin, Institut Pasteur, Dept. of Immunology, 25 rue du Docteur ROUX, 75015 Paris Cedex, FRANCE STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: Y16067 Related sequence Y09526. BASE COUNT 595 a 334 c 284 g 460 t 9102 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~A C--------- ----cuuaaa 301 |gcu--agc| cu-------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---- ---------- |------aac 841 uAA(AACA)U Ucuuca---- ---------- ---------- ---------- ---------- 901 ------(--- --)------- |ccc-uuaA- -GUAU-G(-G GCGA)CAGAA -caagg---- 961 -------<-- --accuc--- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- --AGCGCAAU AGCU-UA--- ---UGUACC( -GCAA-)GGG ---AAA-GC- 1681 UGaaaaagaa augaaauaaa uaauu----- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 ---------- -----aaa-G U-AAAA GCAGAG---- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--auuaacc 2041 --)------- -----CUC-G UACCUU(UG- GCAUC)AUGA |UUU-AAUUA GAaaa--ac- 2101 uaggcaaag- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- agac->---- --(------) ---------- ---------- -cuuaagucu 2701 acc-cuCCCG AA-ACUAA-A CG-AGCUACU CCG-AAG-CA GC-------- ---------- 2761 -(-------- ---------- ---------- ---------- auuau-aga) ---------- 2821 ---GCUAA-C CC-GUCUCU( GUGGCAA-A) AGAG-UGGGA --AGACUUC- CGAGUAG-UG 2881 GU(G-ACAA) GCC-UACC-G A-GUUUAGUG AUAGCU-GGU UACCC--AAG AA-AAG-AAC 2941 (-UUUA)AUU CU-GC-AUUA AUC-<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->-- ---|------ 3061 -|------|- ---------- ---------- --------(- --------)< cccuuucuac 3121 uaaa-----u aagaaucuuc uuauuaaa-- ---------- ---------- ---------- 3181 ----guuaaa cauaga---- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ----|----- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ------ga-u -uaau-AGUU AUUUA--GA- AG-AG(-GAA 3481 CAG)CCCUUC UA-AA----- -UUAAG(AUA -CAA)CUU-u uuaag-g-ug -gu-UAA--- 3541 --ugaucaua auuauua-a- g-guuu---- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ------uuuc c<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->UCAGU-G GGC(CUAAAA 3781 GC-A)-GCCA -CCUG|u(u- aa)-|GUAAG C(--GUCACA )GC|-uCua- guuu--<--- 3841 uu-uaaaaac ccauaauuua gauauuuau- ---------- ---------- ---------- 3901 ->-------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|uc aaaa--acc| cc-c-uu|-- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ---------- ----aacccu aUUGG-GU|- UA-UUUUAUA u--------- 4501 ---------- ---------- (aaaau--)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- -|-------| UAUAAAAGAA CUUAUGU-UA 4681 AA|AUGAGUA -AUAA-GA-- GG-------- (-auaaacc- ---------- ---------- 4741 ---------- -----)---- ---uc-|ucc ----cg-ACA CAA--gugua u|----guca 4801 gaaa----ga ---------- ----(-auua aa)u-c|--a cugaua---- ---------- 4861 ---auuaaa- -cga------ ---------- -------(-- ---------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--------- ---------- ---------- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ---<------ 5701 ---------- --ucccagac ugaggccauc auaacuucau uucuugacua gaaaacccua 5761 ucuuacuau- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---------- ---------- --ucgu-|-- 6481 ---UAACCC- -(AACACA)G G|AGUGU--- ----(-cuua a-----)--- -----ggaa| 6541 |---AGAU-U A--AAAGAAA -GUAA-AGGA ACUCGGCAAA ---------- ----(----- 6601 )--------- ---|------ ---------- -----(---- ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->------ ---------- 6781 ----|-(--- )--------c auAAACUC|C GC---CUG-U UU(ACCAA)A AA-CACC-GC 6841 CUCUUG|--- ---------- ---------- (-cuuacca- ------)--- ---------- 6901 ---------- UAA-GAGGUC CCGCCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CU-GU|G AC-------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------a au-)------ ---------- ---------| 7141 ---GUUC-AA C-|GG-C|-C -GCGGU-(AU -UUUG)ACCG UG|C(AAA)- GG-UAGCGUA 7201 AUC-AC-U-U |GUCUUU(-U AAAU-)GAAG AC|CC-GUAU GAAAGGCACC A-CGAGAGUU 7261 UG-------- ---------- -------ACU GUCUCUACUC UCUA-AU-CA ----AUGAAA 7321 UU|G|AUCUU CU-CG(U-GC AGAAG)CGAG UAU----GAU AACAUAAGAC GAGAAG-ACC 7381 CUAUGG-|-A GCUUC--AAA UA|--c-aua aau--ua--| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<------a uuauguacau auuaauaauc 7561 ccaggacaua aacaaaaaau auaauacuuc ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- --uaa-u-uu -aac--U-AU UUUUGGUUG( 8161 GGG)UG-AC- C|AAGGGG(- --------AA AAAUGAAUC- )CCCC-UU|A |u|cg---|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ------accg 8341 aguauuca-- aauac----- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 -----uuaaa aguua-gaa( -uuacaa--- )uucua-acc gauaaaaauu uuau------ 8821 ---------- ---------- ---------- ---------- ---------- ---------c 8881 g|---aaaaa UGACC-cagg ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- -------auu uu)--|---c 9001 cugAUCAAU- |GAA-CCAAG UUACCC|UAG G|GAUAACAG |C-GCA-A-U CCUUUUUCAG 9061 AG(U--UCCU )AUCGACAAA --AGGGUUUA CG-ACCUCGA UGUU|GG--A U|C|AGGAC| 9121 AU-CC-UAAU GG-UG(--CA -AC)CGCUAU UAAG-GGU|U CGUU(UGUUC )AACGA-UUA 9181 A-uAGUCCU- --ACGUGAUC UGAGUUCAGA CC|GG-A(GA AA)UCCAGGU CAGUUUCUAU 9241 CU|aug---- --|-|<---- ---------- ---------- ---------- -----aauu- 9301 >--------- ---------- -uA-UUU-UU CC--(UAGU- AC(-GAAA)G GACC-)GGAG 9361 A--AA-<--- ---------- ---------- -------->- uggggcc-aa ua-------- 9421 -|-------- (-----) 9541 ---------- ---------- cacg-ccuca uu-------- ---------- -------uuc 9601 ---------- ---aucuauu (gaacca--a acuaa)a-au -ag-auaaga a--------- 9661 ---------- -------<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 --------aa gauuaucuau u----->--| ------(--- )--------- -------|gc 9961 cc-(aagaaa a--)-ggguu ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS mt.M.manaz 10775 bp RNA RNA 12-SEP-1998 DEFINITION Mitochondrion Mustelus manazo.; . ACCESSION AB015962 KEYWORDS . SOURCE Mitochondrion Mustelus manazo. ORGANISM Mitochondrion Mustelus manazo. REFERENCE 1 (sites) AUTHORS Cao,Y., Waddell,P.J., Okada,N. and Hasegawa,M. TITLE The complete mitochondrial DNA sequence of the shark (Mustelus manazo): Evaluating rooting contradictions to living bony vertebrates JOURNAL Mol. Biol. Evol. (1998) In press STANDARD No information REFERENCE 2 (bases 1 to 16707) AUTHORS Cao,Y. TITLE Direct Submission JOURNAL Submitted (07-JUL-1998) to the DDBJ/EMBL/GenBank databases. Ying Cao, The Institute of Statistical Mathematics; 4-6-7 Minami-Azabu, Minato-ku, Tokyo 106-8569, Japan (E-mail:cao@ism.ac.jp, Tel: +81-3-5421-8748, Fax: +81-3-5421-8796) STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: AB015962 BASE COUNT 596 a 336 c 284 g 454 t 9105 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~A C--------- ----cuuaaa 301 |acu--agc| cu-------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---- ---------- |------aac 841 uAA(AACA)U Uuuaa----- ---------- ---------- ---------- ---------- 901 ------(--- --)------- |ccu-ucuA- -GUAU-G(-G GUGA)CAGAA -caaua---- 961 -------<-- --acuca--- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- --AGAGCAAU AGCU-UA--- ---UGUACC( -GCAA-)GGA ---AAA-GC- 1681 UGaaaaagaa augaaauaaa ucauu----- ---------- ---------- ---------- 1741 ---------- -(-------) ---------- ---------- ---------- ---------- 1801 ---------- -----aaa-G U-AAAA GCAGAG---- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--auuacac 2041 --)------- -----CUC-G UACCUU(UU- GCAUC)AUGA |UUU-AGCUA GAaaa--ac- 2101 uaggcgaaa- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- agau->---- --(------) ---------- ---------- -cuuaagucu 2701 auc-cuCCCG AA-ACUAA-A CG-AGCUACU CCG-AAG-CA GC-------- ---------- 2761 -(-------- ---------- ---------- ---------- auuauuaga) ---------- 2821 ---GCUAA-C CC-GUCUCU( GUGGCAA-A) AGAG-UGGGA --AGACUUC- CGAGUAG-CG 2881 GU(G-AAAA) GCC-UACC-G A-GUUUAGUG AUAGCU-GGU UACCC--AAG AA-AAG-AAC 2941 (-UUUA)GUU CU-GC-AUUA ACU-<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->-- ---|------ 3061 -|------|- ---------- ---------- --------(- --------)< cuuuacuauc 3121 uaga-----c aagaauuucu cgucaaa--- ---------- ---------- ---------- 3181 ----gaaaac uauaag---- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ----|----- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- ------ag-u -uaau-AGUU AUUUA--GA- AG-AG(-GUA 3481 CAG)CCCUUC UA-AA----- -CUAAG(AUA -CAU)CUU-u uaaag-a-ug -gg-AAA--- 3541 --ugaucaua auuauua-a- g-guuu---- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ------ccac c<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->CCAGU-G GGC(CUAAAA 3781 GC-A)-GCCA -CCUG|u(u- aa)-|GUAAG C(--GUCGCA )GC|-ucca- gucu--<--- 3841 aacacuaaac cuauaauuua gauauuuac- ---------- ---------- ---------- 3901 ->-------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|uc auaa--ccc| c--c-uu|-- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- --------(- 4441 ------)--- ---------- ----uauccu aUUGG-GU|- UA-UUUUAUA a--------- 4501 ---------- ---------- (aaa----)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- -|-------| UAUAAAAGAA CUUAUGC-UA 4681 AA|AUGAGUA -AUAA-AGA- ga-------- (-acaaauc- ---------- ---------- 4741 ---------- -----)---- ---uc-|ucc ----cg-ACA UAA--gugua c|----guca 4801 gaaa----ga ---------- ----(-auua aa)u-c|--a cugaca---- ---------- 4861 ---auuaau- -cga------ ---------- -------(-- ---------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--------- ---------- ---------- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ---<------ 5701 ---------- --ccccagac ugaggucauu auacuauuaa aucauuaacu agaaaaccuu 5761 auucuucuau ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---------- ---------- --ucgu-|-- 6481 ---UAAUCC- -(CACACA)G G|AAUGU--- ----(-cacc a-----)--- -----ggaa| 6541 |---AGAU-U A--AAAGAAA -AUAA-AGGA ACUCGGCAAA ---------- ----(----- 6601 )--------- ---|------ ---------- -----(---- ---)<----- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- --->------ ---------- 6781 ----|-(--- )--------c acAAACUC|C GC---CUG-U UU(ACCAA)A AA-CAUC-GC 6841 CUCUUG|--- ---------- ---------- (-uuaaauua ------)--- ---------- 6901 ---------- UAA-GAGGUC CCGCCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CU-GU|G AC-------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------a au-)------ ---------- ---------| 7141 ---GUUC-AA C-|GG-C|-C -GCGGU-(AU -UUUG)ACCG UG|C(AAA)- GG-UAGCGUA 7201 AUC-AU-U-U |GUCUUU(-U AAAU-)GAAG AC|CC-GUAU GAAAGGCACC A-CGAGAGUU 7261 UA-------- ---------- -------ACU GUCUCUAUUU UCUA-AU-CA ----AUGAAA 7321 UU|G|AUCUA UU-CG(U-GC AGAAG)CGAA UAU----AAU AACAUUAGAC GAGAAG-ACC 7381 CUAUGG-|-A GCUUU--AAA CA|--c-uua agu--ua--| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<------a uuauguaacc auuuauuccu 7561 cagggua-ua aacaaaauau auaauacuuc ---------- ---------- ---------- 7621 ---------- ---------- ---------> --(------- -)-------- ---------- 7681 ---------- -------|-- ---------- ---------- ---------- ---------- 7741 -----(---- ----)----- ---------- ---------- ---------- --------<- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ----->---- --uaa-c-uu -aac--U-GU UUUUGGUUG( 8161 GGG)UG-AC- C|GAGGGG(- --------GA AAACAAAUC- )CCCC-UC|A |u|cg---|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ------auug 8341 aguacuca-- guacu----- ---------- ---------- ---------- ->-------- 8401 ---|------ ------<--- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------> (--------- )--------- ---------- ---------- 8701 ---------- ---------- ---------- -------|-- (-|-----)- ---------- 8761 ------ugaa aauca-gaa( -uaacaa--- )uucug-auu aauaaaauau uuau------ 8821 ---------- ---------- ---------- ---------- ---------- ---------c 8881 g|---aaaaa UGACC-cagg ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- --------au uu)--|---c 9001 cugAUCAAU- |GAA-CCAAG UUACCC|UAG G|GAUAACAG |C-GCA-A-U CCUUUCUCAG 9061 AG(U--UCCU )AUCGAAGAA --AGGGUUUA CG-ACCUCGA UGUU|GG--A U|C|AGGAC| 9121 AU-CC-UAAU GG-UG(--CA -AC)CGCUAU UAAG-GGU|U CGUU(UGUUC )AACGA-UUA 9181 A-uAGUCCU- --ACGUGAUC UGAGUUCAGA CC|GG-A(GA AA)UCCAGGU CAGUUUCUAU 9241 CU|aug---- --|-|<---- ---------- ---------- ---------- -----aaua- 9301 >--------- ---------- -uA-CUU-UU CC--(UAGU- AC(-GAAA)G GACC-)GGAA 9361 A--AG-<--- ---------- ---------- -------->- uggggcc-aa ug-------- 9421 -|-------- (-----) 9541 ---------- ---------- cacg-cccca uu-------- ---------- -------uuc 9601 ---------- ---aucuauu (gaauaa--a acuua)a-au -ag-auaaga a--------- 9661 ---------- -------<-- ---------- ---------- ---------- ---------- 9721 ---------- ---------- ---------- ---------- ---------- ---------- 9781 ---------- ---------- ---------- ---------- ---------- ---------- 9841 ---------- ---------- ---------- ---------- ---------- ---------- 9901 --------aa gaucacccac u----->--| ------(--- )--------- -------|gc 9961 cc-(aaaaac a--)-ggguu ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (12)-bony 10775 bp RNA RNA 09-JAN-1999 DEFINITION bony vertebrates. ACCESSION No information KEYWORDS No information. SOURCE bony vertebrates. ORGANISM bony vertebrates. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (13)-Actin 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (14)-CHOND 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS mt.P.ornat 10775 bp RNA RNA 09-NOV-1996 DEFINITION Mitochondria Polypterus ornatipinnis.; . ACCESSION U62532 KEYWORDS . SOURCE Mitochondria Polypterus ornatipinnis. ORGANISM Mitochondria Polypterus ornatipinnis. REFERENCE 1 (bases 1 to 16624) AUTHORS Noack,K., Zardoya,R. and Meyer,A. TITLE (Polypterus ornatipinnis), a basal ray-finned fish: Ancient establishment of the consensus vertebrate gene order The complete mitochondrial DNA sequence of the bichir JOURNAL Genetics 144 (3), 1165-1180 (1996) STANDARD No information REFERENCE 2 (bases 1 to 16624) AUTHORS Noack,K., Zardoya,R. and Meyer,A. TITLE Direct Submission JOURNAL Submitted (28-JUN-1996) Ecology & Evolution, State University of New York at Stony Brook, 661 Life Sciences, Stony Brook, NY 11794-5245, USA STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: U62532 BASE COUNT 603 a 347 c 315 g 390 t 9120 others ORIGIN 1 |~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 61 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 121 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 181 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 241 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~G C--------- ----auuaua 301 |gcu--agc| cu-------- -|-------- ---------- ---------| -----(---- 361 ---------) -|-------- -------|-- -------(-- ---------- ---------- 421 -------)-- ---------- ---------- ---------- ---------- -----(---- 481 )---|----- --(-----)- ---------- ---------- ---------- -(------)- 541 ---------- ---------- ---- ---------- |-------aa 841 cAA(AACA)U Uug------- ---------- ---------- ---------- --------uu 901 ------(--- --)------- |aac-uucA- -GUAU-A(-G GCGA)UAGAA -agaga---- 961 -------<-- --acaa---- ---------- ---------- ---------- ---------- 1021 ---------- ---------- ---------- ---------- ---------- ---------- 1081 ---------- ---------- ---------- ---------- ---------- ---------- 1141 ---------- ---------- ---------- ---------- ---------- --->------ 1201 ---------- ---------- ---------- ---------< ---------- ---------- 1261 ---------- ---------- ---------> (------)-- ---------- ---|-(---) 1321 -------(-- -----)---- ---------- ---------- ---------- --<------- 1381 ---------- ---------- ---------- ---------- ---------- ---------- 1441 ---------- ---------- ---------- ---------- ---------- ---------- 1501 ---------- ---------- ---------- >--------- ------(--- ---------- 1561 -------)-- ---------- ---------- -(-------) ---------- ---------- 1621 ---------- A-AGAGCUAU AGCA-AC--- ---AGUACC( -GCAA-)GGG ---AAA-GC- 1681 ugaaagagaa augaaacaaa ucguu----- ---------- ---------- ---------- 1741 ---------- ---------- ---------- ---------- ---------- ---------- 1801 ---------- -----aaa-G C-CAUA GCAGAG---- --------<- ---------- ---------- ---------- 1921 ---------- ---------- ---------- ---------- ---------- ---------- 1981 ---------- ---------- ---------- ---------- ---------> (--auuaaau 2041 --)------- -----CUC-G UACCUU(UU- GCAUC)AUGA |UCU-AGUAA GUaag--cc- 2101 caagcaaaa- ---------- -------(-- ---------- ---------- ---------- 2161 ---------- ---------- ---------- ---------- ---------- ---------- 2221 ---------- ---------- ---------- ---------- ---------- ---------- 2281 ---------- ---------- ---------- ---------- ---------- ---------- 2341 ---------- ---------- ---------- ---------- ---------- ---------- 2401 ---------- ---------- ---------- ---------- ---------- ---------- 2461 ---------- ---------- ---------- ---------- -)-------- ---------- 2521 ----(----- )-----<--- ---------- ---------- ---------- ---------- 2581 ---------- ---------- ---------- ---------- ---------- ---------- 2641 ---------- ugau->---- --(------) ---------- ---------- -uuauaguuu 2701 gac-ccccCG AA-ACUAG-A CG-AGCUACU UCG-AGG-CA GUU------- ---------- 2761 -(-------- ---------- ---------- ---------- ----gaaag) ---------- 2821 --GACCAC-C CC-GUCUCU( GUGGAAA-A) AGAG-UGGGA --AGACUUC- CAAGUAG-AG 2881 GU(G-ACAA) GCC-UAAC-G A-GCCUAGUG AUAGCU-GGU UACUU--GAG AA-AUG-GAU 2941 (-AAAA)GUC CA-GC-CUCA AAAU<----- ---------- ---------- ---------- 3001 ---------- ---------- ---------- ---------- ------->-- ---|------ 3061 -|------|- ---------- ---------- --------(- --------)< uucuaaaaaa 3121 uaua-----c aaauuccguu uaaaaaa--- ---------- ---------- ---------- 3181 ----uu--uu aag--aa--- ---------- ---------- ---------- ---------- 3241 ---------- ---------- ---------- ---------- ---->----- ---------- 3301 ---------- ---------- ----|----- ---------- ---------- ---------- 3361 ---------- ---------- ---------- ---------- ---------- ---------- 3421 ---------- ---------- -----cAU-U -UGAG-AGUU AUUCA--cA- GG-AG(-GUA 3481 CAG)CUCCUA UG-AA----- -cuGGG(AAA -CAA)CCC-a auaag-g-ag -ga-AAA--- 3541 --agaucaua auuuaca-a- ggacaa---- ---------- ---------- ---------- 3601 ---------- ---------- ---------- ---------- ---------- ---------- 3661 ---------- ---------- ------aauc c<-------- ---------- ---------- 3721 ---------- ---------- ---------- ---------- -->-AAGU-G GGC(CUGAAA 3781 GC-A)-GCCA -CCUU|-(ua -a)a|GAAAG C(--GUUAUA )GC|-UUAa- auaa--<--- 3841 --uauauuau uccguauauc cggauaaaa- ---------- ---------- ---------- 3901 ->-------- -------|-- ---------- ---------- ---------- ---------- 3961 ---------- ---------- ---------- ---------- ---------- ---------- 4021 ---------- ---------- ---------- ---------- ---------- ---------- 4081 -------|uc ucugaaucc| c--c-ua|-- ---------- ---------- ---------- 4141 ---------- ---------- ---------- ---------- ---------- ---------- 4201 ---------- ---------- ---------- ---------- ---------- ---------- 4261 ---------- ---------- ---------- ---------- ---------- ---------- 4321 ---------- ---------- ---------- ---------- ---------- ---------- 4381 ---------- ---------- ---------- ---------- ---------- ---------- 4441 ---------- ---------- ---------- caaau-AU|- CA-AGUUAUU ---------- 4501 ---------- ---------- (cuauuug)< ---------- ---------- ---------- 4561 ---------- ---------- ---------- ---------- ---------- ---------- 4621 ---------- ------->-- ---------- ---------| AGUAGAAGAA AUUAUGC-UA 4681 GA|ACUAGUA -AUAA-GAA- aaa------- (-u-g-auu- ---------- ---------- 4741 ---------- -----)---- ---uuc|ucc u----a-GCA CAA--gugua a|----guua 4801 gaac----gg ---------- ----(--aca aa)c-c|--a cuaaca---- ---------- 4861 ---auuaga- -cga------ ---------- -------(-- ---------- ------)<-- 4921 ---------- ---------- ---------- ---------- ---------- ---------- 4981 >--------- ---------- ---------- ----(----- ---------- ---------- 5041 ---------- ---------- ----)----- |-----|--- ---------- |--<------ 5101 ---------- ---------- ---------- ---------- ---------- ---------- 5161 ---------- ---------- ---------- ---------- ---------- ---------- 5221 ---------- ---------- ---------- ---------- ---------- ---------- 5281 ---------- ---------- ---------- ---------- ---------- ---------- 5341 ---------- ---------- ---------- ---------- ---------- ---------- 5401 ---------- ---------- ------->-- ---------- ---------- ---------- 5461 -----(---- ------)--- ---|------ --------|- ---------- -(-----)-- 5521 |--------- ---------- ---------- -----(---- )--------- ---------- 5581 --<------- ---------- ---------- ---------- ---------- ---------- 5641 ---------- ---------- ------->-- ---------- ---------- ---<------ 5701 ---------- acccaacaga gggccaaaua acgccuauaa uaaaaacaag aaaacccuau 5761 uaaucuua-- ---------- ---------- ---------- ---------- ---------- 5821 ---------- ---------- ---------- ---------- ---------- ---------- 5881 ---------- ---------- ---------- ---------- ---------- ---------- 5941 ---------- ---------- ---------- ---------- ---------- ---------- 6001 ---------- ---------- ---------- ---------- ---------- ---------- 6061 ---------- ---------- ---------- ---------- ---------- ---------- 6121 ---------- ---------- ---------- ---------- ---------- ---------- 6181 ---------- ---------- ---------- ---------- ---------- ---------- 6241 ---------- ---------- ---------- ---------- ---------- ---------- 6301 ---------- ---------- ---------- ---------- ---------- ---------- 6361 ---------- ---------- ---------- ---------- ---------- ---------- 6421 ---------- ---------- ------>--- ---------- ---------- --ucgu-|-- 6481 ---AAAUCU- -(UACACA)A G|AGUGC--- ----(cuaa- ------)--- ----aggaa| 6541 |---AGAC-U A--AAAGAGA -AAAA-AGGA ACUCGGCAAA ---------- ---------- 6601 ---------- ---------- ---------- ---------- ---------- ---------- 6661 ---------- ---------- ---------- ---------- ---------- ---------- 6721 ---------- ---------- ---------- ---------- ---------- ---------- 6781 ------(--- )--------u ccGAGCCC|C GC---CUG-U UU(ACCAA)A AA-CAUC-GC 6841 CUUCAG|C-- ---------- ---------- (--uuuucau ------)--- ---------- 6901 ------GUA- UUG-AAGGUC CUGCCU<--- ---------- ---------- ---------- 6961 ---------- ---------- -------->G CC-CA-GU|G AC-------- ---------- 7021 ---------- --(------- ---------- ---------- ---------- ---------- 7081 ---------- ---------- ---------a uga)------ ---------- ---------| 7141 ---GUUU-AA C-|GG-C|-C -GCGGU-(AU -CCUG)ACCG UG|C(AAA)- GG-UAGCGUA 7201 AUC-AC-U-U |GUUCUU(-U AAAU-)GAGG AC|UG-GUAU GAAUGGCCCC A-CGAGGGCU 7261 CA-------- ---------- -------ACU GUCUCuuuuu cuccgGU-CA ----AUUAAA 7321 CU|G|AUCUC CCCUG(U-GC AGAAG)CGGG CAU----AAA GACAUAAGAC GAGAAG-ACC 7381 CUGUGG-|-A GCUUU--AGA CU|--a-aau ccaa---a-| <--------- ---------- 7441 ---------- ---------- --->------ ---------- ---------- ---------- 7501 ---------- ---------- ---------- --<------- -cacuccuca cuauauuuua 7561 ccgu--aua- -gac--aaac acagcgu--- ---------- ---------- ---------- 7621 ---------- ---------- ---------- ---------- ---------- ---------- 7681 ---------- ---------- ---------- ---------- ---------- ---------- 7741 ---------- ---------- ---------- ---------- ---------- ---------- 7801 ---------- ---------- ---------- ---------- ---------- ---------- 7861 ---------- ---------- ---------- ---------- ---------- ---------- 7921 ---------- ---------- ---------- ---------- ---------- ---------- 7981 ---------- ---------- ---------- ---------- ---------- ---------- 8041 ---------- ---------- ---------- ---------- ---------- ---------- 8101 ---------- ---------- ---------- --uau-g-gc caua-aA-GU CUUAGGUUG( 8161 GGG)CG-AC- C|ACUGAG(- --------AA CAAAUAAUC- )CUCA-GC|G |a|ug---|< 8221 ---------- ---------- ---------- ---------- ---------- ---------- 8281 ---------- ---------- ---------- ---------- ---------- ------auug 8341 aagcacagcu uuau------ ---------- ---------- ---------- ->-------- 8401 ---------- ---------- ---------- ---------- ---------- ---------- 8461 ---------- ---------- ---------- ---------- ---------- ---------- 8521 ---------- ---------- ---------- ---------- ---------- ---------- 8581 ---------- ---------- ---------- ---------- ---------- ---------- 8641 ---------- ---------- ---------- ---------- ---------- ---------- 8701 ---------- ---------- ---------- ---------- --|------- ---------- 8761 --------aa acuaa-gaa( -ugacaa--- )uucaa-agc -aucaggaca ccug------ 8821 ---------- ---------- ---------- ---------- ---------- --------ac 8881 a|---uu-ag -GAUC-caga ---------- ---------- ---(------ ---------- 8941 ---------- ---------- ---------- ---------- --------cu aa)--|---u 9001 cugAUCAAC- |GAA-CCAAG UUACCC|CAG G|GAUAACAG |C-GCA-A-U CUUUUCCAAG 9061 AG(C--CCAA )AUCGACGAA --AAGGUUUA CG-ACCUCGA UGUU|GG--A U|C|AGGAC| 9121 AU-CC-UAAU GG-UG(--CA -UC)CGCUAU UAAG-GGU|U CGUU(UGUUC )AGCGA-UUA 9181 A--AGUCCU- --ACGUGAUC UGAGUUCAGA CC|GG-A(GC AA)UCCAGGU CAGUUUCUAU 9241 CU|AUG---- --|-|<---- ---------- ---------- ---------- ---u-aguc- 9301 >--------- ---------- --A-UUU-AU CC--(UAGU- AC(-GAAA)G GAUU-)GGAU 9361 A--AA-- ggggccu-au au-------- 9421 -|-------- (-----) 9541 ---------- ---------- acac-gcccc cuu------- ---------- -------uua 9601 ---------- ---accuacu (gaagcc--a aauca)a-gu -ag-auaaua aa-------- 9661 ---------- ---------| ------(--- )--------- -------|gc 9961 cc-(uagaac a--)-ggguu a~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10021 ~|~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10081 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~(~ ~~~~~~~~~~ 10141 ~~~~~~~~~~ ~~~~~~~~~~ ~)~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10201 ~~~~~~~~~~ ~|~|~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10261 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10321 ~~~~~~~~|~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10381 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10441 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10501 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10561 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10621 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10681 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ 10741 ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ||||| // LOCUS (14)-Neopt 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (15)-TELEO 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (16)-EUTEL 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (17)-OSTAR 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (18)-CYPRI 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......... .......... .......... 841 .......... .......... .......... .......... .......... .......... 901 .......... .......... .......... .......... .......... .......... 961 .......... .......... .......... .......... .......... .......... 1021 .......... .......... .......... .......... .......... .......... 1081 .......... .......... .......... .......... .......... .......... 1141 .......... .......... .......... .......... .......... .......... 1201 .......... .......... .......... .......... .......... .......... 1261 .......... .......... .......... .......... .......... .......... 1321 .......... .......... .......... .......... .......... .......... 1381 .......... .......... .......... .......... .......... .......... 1441 .......... .......... .......... .......... .......... .......... 1501 .......... .......... .......... .......... .......... .......... 1561 .......... .......... .......... .......... .......... .......... 1621 .......... .......... .......... .......... .......... .......... 1681 .......... .......... .......... .......... .......... .......... 1741 .......... .......... .......... .......... .......... .......... 1801 .......... .......... .......... .......... .......... .......... 1861 .......... .......... .......... .......... .......... .......... 1921 .......... .......... .......... .......... .......... .......... 1981 .......... .......... .......... .......... .......... .......... 2041 .......... .......... .......... .......... .......... .......... 2101 .......... .......... .......... .......... .......... .......... 2161 .......... .......... .......... .......... .......... .......... 2221 .......... .......... .......... .......... .......... .......... 2281 .......... .......... .......... .......... .......... .......... 2341 .......... .......... .......... .......... .......... .......... 2401 .......... .......... .......... .......... .......... .......... 2461 .......... .......... .......... .......... .......... .......... 2521 .......... .......... .......... .......... .......... .......... 2581 .......... .......... .......... .......... .......... .......... 2641 .......... .......... .......... .......... .......... .......... 2701 .......... .......... .......... .......... .......... .......... 2761 .......... .......... .......... .......... .......... .......... 2821 .......... .......... .......... .......... .......... .......... 2881 .......... .......... .......... .......... .......... .......... 2941 .......... .......... .......... .......... .......... .......... 3001 .......... .......... .......... .......... .......... .......... 3061 .......... .......... .......... .......... .......... .......... 3121 .......... .......... .......... .......... .......... .......... 3181 .......... .......... .......... .......... .......... .......... 3241 .......... .......... .......... .......... .......... .......... 3301 .......... .......... .......... .......... .......... .......... 3361 .......... .......... .......... .......... .......... .......... 3421 .......... .......... .......... .......... .......... .......... 3481 .......... .......... .......... .......... .......... .......... 3541 .......... .......... .......... .......... .......... .......... 3601 .......... .......... .......... .......... .......... .......... 3661 .......... .......... .......... .......... .......... .......... 3721 .......... .......... .......... .......... .......... .......... 3781 .....-.... .......... .......... .......... .......... .......... 3841 .......... .......... .......... .......... .......... .......... 3901 .......... .......... .......... .......... .......... .......... 3961 .......... .......... .......... .......... .......... .......... 4021 .......... .......... .......... .......... .......... .......... 4081 .......... .......... .......... .......... .......... .......... 4141 .......... .......... .......... .......... .......... .......... 4201 .......... .......... .......... .......... .......... .......... 4261 .......... .......... .......... .......... .......... .......... 4321 .......... .......... .......... .......... .......... .......... 4381 .......... .......... .......... .......... .......... .......... 4441 .......... .......... .......... .......... .......... .......... 4501 .......... .......... .......... .......... .......... .......... 4561 .......... .......... .......... .......... .......... .......... 4621 .......... .......... .......... .......... .......... .......... 4681 .......... .......... .......... .......... .......... .......... 4741 .......... .......... .......... .......... .......... .......... 4801 .......... .......... .......... ..)....... .......... .......... 4861 .......... .......... .......... .......... .......... .......... 4921 .......... .......... .......... .......... .......... .......... 4981 .......... .......... .......... .......... .......... .......... 5041 .......... .......... .......... .......... .......... .......... 5101 .......... .......... .......... .......... .......... .......... 5161 .......... .......... .......... .......... .......... .......... 5221 .......... .......... .......... .......... .......... .......... 5281 .......... .......... .......... .......... .......... .......... 5341 .......... .......... .......... .......... .......... .......... 5401 .......... .......... .......... .......... .......... .......... 5461 .......... .......... .......... .......... .......... .......... 5521 .......... .......... .......... .......... .......... .......... 5581 .......... .......... .......... .......... .......... .......... 5641 .......... .......... .......... .......... .......... .......... 5701 .......... .......... .......... .......... .......... .......... 5761 .......... .......... .......... .......... .......... .......... 5821 .......... .......... .......... .......... .......... .......... 5881 .......... .......... .......... .......... .......... .......... 5941 .......... .......... .......... .......... .......... .......... 6001 .......... .......... .......... .......... .......... .......... 6061 .......... .......... .......... .......... .......... .......... 6121 .......... .......... .......... .......... .......... .......... 6181 .......... .......... .......... .......... .......... .......... 6241 .......... .......... .......... .......... .......... .......... 6301 .......... .......... .......... .......... .......... .......... 6361 .......... .......... .......... .......... .......... .......... 6421 .......... .......... .......... .......... .......... .......... 6481 .......... .......... .......... .......... .......... .......... 6541 .......... .......... .......... .......... .......... .......... 6601 .......... .......... .......... .......... .......... .......... 6661 .......... .......... .......... .......... .......... .......... 6721 .......... .......... .......... .......... .......... .......... 6781 .......... .......... .......... .......... .......... .......... 6841 .......... .......... .......... .......... .......... .......... 6901 .......... .......... .......... .......... .......... .......... 6961 .......... .......... .......... .......... .......... .......... 7021 .......... .......... .......... .......... .......... .......... 7081 .......... .......... .......... .......... .......... .......... 7141 .......... .......... .......... .......... .......... .......... 7201 .......... .......... .......... .......... .......... .......... 7261 .......... .......... .......... .......... .......... .......... 7321 .......... .......... .......... .......... .......... .......... 7381 .......... .......... .......... .......... .......... .......... 7441 .......... .......... .......... .......... .......... .......... 7501 .......... .......... .......... .......... .......... .......... 7561 .......... .......... .......... .......... .......... .......... 7621 .......... .......... .......... .......... .......... .......... 7681 .......... .......... .......... .......... .......... .......... 7741 .......... .......... .......... .......... .......... .......... 7801 .......... .......... .......... .......... .......... .......... 7861 .......... .......... .......... .......... .......... .......... 7921 .......... .......... .......... .......... .......... .......... 7981 .......... .......... .......... .......... .......... .......... 8041 .......... .......... .......... .......... .......... .......... 8101 .......... .......... .......... .......... .......... .......... 8161 .......... .......... .......... .......... .......... .......... 8221 .......... .......... .......... .......... .......... .......... 8281 .......... .......... .......... .......... .......... .......... 8341 .......... .......... .......... .......... .......... .......... 8401 .......... .......... .......... .......... .......... .......... 8461 .......... .......... .......... .......... .......... .......... 8521 .......... .......... .......... .......... .......... .......... 8581 .......... .......... .......... .......... .......... .......... 8641 .......... .......... .......... .......... .......... .......... 8701 .......... .......... .......... .......... .......... .......... 8761 .......... .......... .......... .......... .......... .......... 8821 .......... .......... .......... .......... .......... .......... 8881 .......... .......... .......... .......... .......... .......... 8941 .......... .......... .......... .......... .......... .......... 9001 .......... .......... .......... .......... .......... .......... 9061 .......... .......... .......... .......... .......... .......... 9121 .......... .......... .......... .......... .......... .......... 9181 .......... .......... .......... .......... .......... .......... 9241 .......... .......... .......... .......... .......... .......... 9301 .......... .......... .......... .......... .......... .......... 9361 .......... .......... .......... .......... .......... .......... 9421 .......... .......... .......... .......... .......... .......... 9481 .......... .......... .......... .......... .......... .......... 9541 .......... .......... .......... .......... .......... .......... 9601 .......... .......... .......... .......... .......... .......... 9661 .......... .......... .......... .......... .......... .......... 9721 .......... .......... .......... .......... .......... .......... 9781 .......... .......... .......... .......... .......... .......... 9841 .......... .......... .......... .......... .......... .......... 9901 .......... .......... .......... .......... .......... .......... 9961 .......... .......... .......... .......... .......... .......... 10021 .......... .......... .......... .......... .......... .......... 10081 .......... .......... .......... .......... .......... .......... 10141 .......... .......... .......... .......... .......... .......... 10201 .......... .......... .......... .......... .......... .......... 10261 .......... .......... .......... .......... .......... .......... 10321 .......... .......... .......... .......... .......... .......... 10381 .......... .......... .......... .......... .......... .......... 10441 .......... .......... .......... .......... .......... .......... 10501 .......... .......... .......... .......... .......... .......... 10561 .......... .......... .......... .......... .......... .......... 10621 .......... .......... .......... .......... .......... .......... 10681 .......... .......... .......... .......... .......... .......... 10741 .......... .......... .......... ||||| // LOCUS (19)-CYPRI 10775 bp RNA RNA 09-JAN-1999 DEFINITION . ACCESSION No information KEYWORDS No information. SOURCE No information. ORGANISM No information. REFERENCE 1 AUTHORS No information JOURNAL No information TITLE No information STANDARD No information COMMENTS Sequence information (bases 1 to 10775) Corresponding GenBank entry: DIVIDER BASE COUNT 0 a 0 c 0 g 0 t 10775 others ORIGIN 1 |......... .......... .......... .......... .......... .......... 61 .......... .......... .......... .......... .......... .......... 121 .......... .......... .......... .......... .......... .......... 181 .......... .......... .......... .......... .......... .......... 241 .......... .......... .......... .......... .......... .......... 301 .......... .......... .......... .......... .......... .......... 361 .......... .......... .......... .......... .......... .......... 421 .......... .......... .......... .......... .......... .......... 481 .......... .......... .......... .......... .......... .......... 541 .......... .......... .......... .......... .......... .......... 601 .......... .......... .......... .......... .......... .......... 661 .......... .......... .......... .......... .......... .......... 721 .......... .......... .......... .......... .......... .......... 781 .......... .......... .......... .......